![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn121961 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 132aa MW: 14245.8 Da PI: 7.8613 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 102.8 | 2.2e-32 | 24 | 81 | 2 | 60 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 ++vrY eC+kNhAa++Gg+avDGC+Efm+s geeg + al+CaACgCHRnFHR+eve++ Achn121961 24 SGVRYVECQKNHAANIGGYAVDGCREFMAS-GEEGMTGALTCAACGCHRNFHRKEVETQ 81 579**************************9.999*********************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 6.0E-24 | 24 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.2E-29 | 26 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 4.6E-27 | 27 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.485 | 28 | 77 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009640 | Biological Process | photomorphogenesis | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009735 | Biological Process | response to cytokinin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009741 | Biological Process | response to brassinosteroid | ||||
GO:0043392 | Biological Process | negative regulation of DNA binding | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048509 | Biological Process | regulation of meristem development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MKKHQVVVRK NGSNRGVGNS SVASGVRYVE CQKNHAANIG GYAVDGCREF MASGEEGMTG 60 ALTCAACGCH RNFHRKEVET QESDCSMPVE DSVRSHSQSI LKPAHGHTNP FSLREQLEQS 120 IDSRQVQGQS L* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009591850.1 | 4e-39 | PREDICTED: mini zinc finger protein 1-like | ||||
Refseq | XP_016511425.1 | 4e-39 | PREDICTED: mini zinc finger protein 1-like | ||||
TrEMBL | A0A2R6PUB3 | 4e-52 | A0A2R6PUB3_ACTCH; Mini zinc finger protein | ||||
STRING | XP_009591850.1 | 1e-38 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1105 | 24 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74660.1 | 6e-33 | mini zinc finger 1 |