PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Achn032501

Organism

Actinidia chinensis

Taxonomic ID

3625

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia

Family

bZIP

Protein Properties

Length: 74aa MW: 8732 Da PI: 10.0509

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Achn032501	genome	IKGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	47.4	4.2e-15	3	56	9	62
CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 r+ +NR++A++ R+RKka++ eLe +vk Le++N+++ + l++l++e + l++ Achn032501 3 RLLRNRVSAQEARERKKAYLTELEARVKDLEKKNSEMEEMLSTLQNENQMLRQI 56 899**********************************************99886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50217	11.519	1	60	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	4.4E-17	2	59	No hit	No description
SuperFamily	SSF57959	4.56E-13	2	57	No hit	No description
Pfam	PF00170	3.1E-13	3	57	IPR004827	Basic-leucine zipper domain
PROSITE pattern	PS00036	0	3	17	IPR004827	Basic-leucine zipper domain
CDD	cd14704	8.21E-11	3	51	No hit	No description
SMART	SM00338	2.5E-7	3	59	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 74 aa Download sequence Send to blast
MERLLRNRVS AQEARERKKA YLTELEARVK DLEKKNSEME EMLSTLQNEN QMLRQILKNT 60 TAGMRKEESR SYV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2oqq_A	5e-16	20	59	3	42	Transcription factor HY5
2oqq_B	5e-16	20	59	3	42	Transcription factor HY5
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269\|PubMed:15178762}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028120847.1	1e-31	transcription factor HY5
Swissprot	Q9SM50	1e-29	HY5_SOLLC; Transcription factor HY5
TrEMBL	A0A2R6RWT7	2e-40	A0A2R6RWT7_ACTCH; Transcription factor like
STRING	POPTR_0018s01530.1	1e-30	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA8037	24	30

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G11260.1	2e-31	bZIP family protein

Publications ? help Back to Top
Wang F, et al. Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato. Plant Physiol., 2018. 176(2): p. 1311-1326 [PMID:29146776] Liu CC, et al. The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato. Plant Cell Environ., 2018. 41(8): p. 1762-1775 [PMID:29566255]