![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aan018145 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 128aa MW: 14957 Da PI: 9.6431 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.3 | 2.6e-16 | 43 | 87 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT++E++++++a k++G W+ I +++g ++t+ q++s+ qk+ Aan018145 43 REKWTQDEHKKFLEALKLYGRA-WAQIEEHVG-NKTAIQIRSHAQKF 87 789*****************88.*********.************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 4.34E-16 | 37 | 91 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 20.746 | 38 | 92 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.0E-10 | 39 | 90 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.1E-16 | 41 | 90 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.0E-12 | 42 | 90 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-13 | 43 | 86 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.60E-9 | 45 | 88 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MVEDLSEGYK SITGINNHMD DQITPCEDYA LKSRKPYTIT KQREKWTQDE HKKFLEALKL 60 YGRAWAQIEE HVGNKTAIQI RSHAQKFFSK VVRESSDIDR TTVDNIEIPP PRPKRKPANP 120 YPRNVHIP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Morning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021999531.1 | 7e-56 | protein REVEILLE 1-like | ||||
Swissprot | F4KGY6 | 7e-39 | RVE1_ARATH; Protein REVEILLE 1 | ||||
TrEMBL | A0A2U1NUZ2 | 1e-87 | A0A2U1NUZ2_ARTAN; Myb domain, Homeodomain-like protein | ||||
STRING | Solyc02g036370.2.1 | 3e-42 | (Solanum lycopersicum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G37260.1 | 3e-36 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|