PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aan018145

Organism

Artemisia annua

Taxonomic ID

35608

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia

Family

MYB_related

Protein Properties

Length: 128aa MW: 14957 Da PI: 9.6431

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PUT-183a-Artemisia_annua-29447	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.3	2.6e-16	43	87	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT++E++++++a k++G W+ I +++g ++t+ q++s+ qk+ Aan018145 43 REKWTQDEHKKFLEALKLYGRA-WAQIEEHVG-NKTAIQIRSHAQKF 87 789***************88.*****.**********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	4.34E-16	37	91	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.746	38	92	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	9.0E-10	39	90	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	3.1E-16	41	90	IPR006447	Myb domain, plants
SMART	SM00717	1.0E-12	42	90	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-13	43	86	IPR001005	SANT/Myb domain
CDD	cd00167	2.60E-9	45	88	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
MVEDLSEGYK SITGINNHMD DQITPCEDYA LKSRKPYTIT KQREKWTQDE HKKFLEALKL 60 YGRAWAQIEE HVGNKTAIQI RSHAQKFFSK VVRESSDIDR TTVDNIEIPP PRPKRKPANP 120 YPRNVHIP

Functional Description ? help Back to Top
Source	Description
UniProt	Morning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269\|PubMed:19805390, ECO:0000269\|PubMed:23240770}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269\|PubMed:19805390, ECO:0000269\|PubMed:23240770}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021999531.1	7e-56	protein REVEILLE 1-like
Swissprot	F4KGY6	7e-39	RVE1_ARATH; Protein REVEILLE 1
TrEMBL	A0A2U1NUZ2	1e-87	A0A2U1NUZ2_ARTAN; Myb domain, Homeodomain-like protein
STRING	Solyc02g036370.2.1	3e-42	(Solanum lycopersicum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G37260.1	3e-36	MYB_related family protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xu G, et al. REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis. Photosyn. Res., 2015. 126(2-3): p. 331-40 [PMID:25910753] Jiang Z,Xu G,Jing Y,Tang W,Lin R Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis. Nat Commun, 2016. 7: p. 12377 [PMID:27506149]