PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aan016178 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 108aa MW: 12366.2 Da PI: 9.6003 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.6 | 3e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl Aan016178 14 KGPWTPEEDIILVTYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 41.7 | 2.6e-13 | 67 | 108 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 rg++T E+ +v++ ++lG++ W++Ia++++ Rt++++k++w Aan016178 67 RGNFTSHEEGMIVHLQALLGNK-WAAIASYLP-QRTDNDIKNYW 108 89********************.*********.*********** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.954 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.2E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.0E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.04E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-19 | 65 | 108 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.606 | 66 | 108 | IPR017930 | Myb domain |
SMART | SM00717 | 0.0017 | 66 | 108 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.0E-11 | 67 | 108 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.06E-7 | 69 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MGRPPCCDKV GIKKGPWTPE EDIILVTYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY 60 LRPGIKRGNF TSHEEGMIVH LQALLGNKWA AIASYLPQRT DNDIKNYW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-23 | 12 | 108 | 25 | 120 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During seed development, gradually down-regulated towards the onset of ripening (veraison). During berry skin development, dramatic decrease to full repression at veraison, followed by a slight increase towards ripening. In flowers, barely detectable in stamens, at the interface of filaments and anthers. {ECO:0000269|PubMed:22018045}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to stomatal guard cells. Mostly expressed in leaves, cotyledons, hypocotyls, seeds and ripened berry skins. {ECO:0000269|PubMed:22018045}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016725886.1 | 6e-77 | PREDICTED: myb-related protein 306-like | ||||
Refseq | XP_022743457.1 | 6e-77 | myb-related protein 306-like | ||||
Swissprot | B3VTV7 | 4e-77 | MYB60_VITVI; Transcription factor MYB60 | ||||
TrEMBL | A0A1Q3BPR5 | 1e-75 | A0A1Q3BPR5_CEPFO; Myb_DNA-binding domain-containing protein | ||||
TrEMBL | A0A2U1MJF7 | 4e-76 | A0A2U1MJF7_ARTAN; Myb domain protein 60 | ||||
STRING | Aquca_014_00947.1 | 4e-76 | (Aquilegia coerulea) | ||||
STRING | evm.model.supercontig_73.13 | 3e-76 | (Carica papaya) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 7e-79 | myb domain protein 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|