PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aan014956 | ||||||||
Common Name | BBX22 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 172aa MW: 18676.1 Da PI: 7.2948 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 22.6 | 2.2e-07 | 4 | 45 | 5 | 40 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40 C+ +e+ e++ C ++ lC++C +++H H++v Aan014956 4 QCNVCEKAEATVLCCADEAALCRSCDVKIHAAnklaskHQRV 45 7*****************************666777788765 PP | |||||||
2 | zf-B_box | 29.4 | 1.6e-09 | 53 | 86 | 2 | 35 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35 +++kC+ ++e +fC +++ llC++C +++H Aan014956 53 KMPKCDICQETFGYFFCLEDRALLCRKCDVAIHT 86 689*******99*********************3 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 9.499 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 6.61E-6 | 3 | 45 | No hit | No description |
Pfam | PF00643 | 2.5E-5 | 4 | 45 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 2.7E-8 | 4 | 47 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 9.158 | 52 | 99 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 1.7E-14 | 52 | 99 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 1.9E-7 | 53 | 95 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 3.74E-7 | 55 | 99 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005622 | Cellular Component | intracellular | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MKIQCNVCEK AEATVLCCAD EAALCRSCDV KIHAANKLAS KHQRVVLTNS DAKMPKCDIC 60 QETFGYFFCL EDRALLCRKC DVAIHTVNTF VSSHQRFLLT GVKVGAEAAD LDTSSTSKKS 120 NATKNSILLS PTVQYNHPVP VQAAPSLPST GGSSVNDIQQ WQFDEFLGLT GX |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as positive regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation, independently and in concert with HY5 and BBX21 (PubMed:18540109, PubMed:18796637, PubMed:18182030, PubMed:21427283). Acts as a positive regulator of de-etiolation and influences chloroplast biogenesis and function through regulation of genes encoding chloroplast proteins (PubMed:18182030). Acts downstream of COP1 and plays an important role in early and long-term adjustment of the shade avoidance syndrome (SAS) responses in natural environments (PubMed:21070414). Regulates the expression of genes responsive to light hormone signals which may contribute to optimal seedling development (PubMed:21427283). {ECO:0000269|PubMed:18182030, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:18796637, ECO:0000269|PubMed:21070414, ECO:0000269|PubMed:21427283}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light. {ECO:0000269|PubMed:18182030}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023765469.1 | 1e-84 | B-box zinc finger protein 23-like | ||||
Swissprot | Q9SYM2 | 4e-63 | BBX22_ARATH; B-box zinc finger protein 22 | ||||
TrEMBL | A0A0A6ZKG7 | 1e-120 | A0A0A6ZKG7_ARTAN; B-box-type zinc finger protein 22 | ||||
STRING | XP_009771048.1 | 3e-71 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G78600.1 | 3e-61 | light-regulated zinc finger protein 1 |