PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aan011769 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 118aa MW: 13328.8 Da PI: 9.5145 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 95.5 | 4e-30 | 44 | 97 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kpr++W+ +LH++Fv av+qL G+ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl Aan011769 44 KPRVVWSIDLHRKFVAAVNQL-GIEKAVPKRILDLMNVEGLTRENVASHLQKYRL 97 79*******************.********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.427 | 41 | 100 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.97E-20 | 41 | 101 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.8E-31 | 41 | 102 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.9E-26 | 44 | 97 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 9.1E-7 | 46 | 96 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MEVKVDKKAG SGDPNGKLNR KRKDDDEDSE DNGNEDDESS TQKKPRVVWS IDLHRKFVAA 60 VNQLGIEKAV PKRILDLMNV EGLTRENVAS HLQKYRLYLK RISQQANMVV AFGGSKDX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 4e-28 | 40 | 103 | 1 | 64 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021990178.1 | 7e-68 | two-component response regulator ARR12-like | ||||
Swissprot | A2X1N2 | 1e-43 | ORR24_ORYSI; Two-component response regulator ORR24 | ||||
Swissprot | Q6H805 | 1e-43 | ORR24_ORYSJ; Two-component response regulator ORR24 | ||||
TrEMBL | A0A2U1MXR4 | 1e-68 | A0A2U1MXR4_ARTAN; Two-component response regulator | ||||
TrEMBL | A0A2U1MXR6 | 3e-68 | A0A2U1MXR6_ARTAN; Two-component response regulator | ||||
STRING | XP_009593176.1 | 3e-51 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G25180.1 | 3e-34 | response regulator 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|