PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aan011331 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 132aa MW: 15224.1 Da PI: 9.351 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.5 | 2.7e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+ eEd+ll ++++ +G g+W++ +++ g+ R++k+c++rw +yl Aan011331 14 RGAWSDEEDKLLTNYIQTHGEGQWRSMPSKAGLLRCGKSCRLRWMNYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 54.6 | 2.5e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E e++++++ +G++ W+ Ia ++ gRt++++k++w+++l Aan011331 67 RGSFTEDENEQIIRLHSIHGNR-WSFIATELK-GRTDNEIKNHWNSHL 112 89********************.********9.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.429 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.4E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.0E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-23 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.23E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.27 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 6.0E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.84E-11 | 69 | 112 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.2E-26 | 69 | 115 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MGRAPCCAKV GLHRGAWSDE EDKLLTNYIQ THGEGQWRSM PSKAGLLRCG KSCRLRWMNY 60 LRPGIKRGSF TEDENEQIIR LHSIHGNRWS FIATELKGRT DNEIKNHWNS HLKRKADNVG 120 DENQPAEDSK NH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-27 | 12 | 118 | 5 | 110 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In seedlings, predominantly expressed in cotyledons. Restricted to the cotyledons and primary leaves. {ECO:0000269|PubMed:17419845}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, cotyledons and young leaves. {ECO:0000269|PubMed:17419845}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269|PubMed:19895401}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024994443.1 | 1e-77 | transcription repressor MYB6-like | ||||
Swissprot | Q9FJ07 | 4e-58 | MY111_ARATH; Transcription factor MYB111 | ||||
TrEMBL | A0A2U1MGB7 | 2e-90 | A0A2U1MGB7_ARTAN; Homeodomain-like protein | ||||
STRING | GLYMA19G44660.1 | 2e-61 | (Glycine max) | ||||
STRING | XP_002518878.1 | 1e-61 | (Ricinus communis) | ||||
STRING | Migut.G00870.1.p | 9e-62 | (Erythranthe guttata) | ||||
STRING | Migut.O00736.1.p | 3e-61 | (Erythranthe guttata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49330.1 | 2e-60 | myb domain protein 111 |