![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aan010871 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 146aa MW: 17185.9 Da PI: 7.7099 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.4 | 7.6e-09 | 52 | 94 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 WT+eE ++l d+++++ + + Ia ++++ Rt +++k+r+++ Aan010871 52 TWTKEETDQLFDLCERFDLR-FVVIADRFPTPRTVEELKNRYYS 94 7*******************.*********88**********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF16282 | 2.2E-32 | 25 | 99 | IPR032563 | DAMP1, SANT/Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-7 | 46 | 97 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.06E-8 | 48 | 101 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-9 | 49 | 98 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
XARKDNLELY HWVRVVNGTP PTGDYSFAKY NKSVDVIKYT DEEYEKHLTD STWTKEETDQ 60 LFDLCERFDL RFVVIADRFP TPRTVEELKN RYYSVSRTIL IARAPSPADV SGHPLVKEPY 120 NISHEIDRKR ALSMVLSQTK HQERKX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3hm5_A | 2e-22 | 24 | 109 | 4 | 93 | DNA methyltransferase 1-associated protein 1 |
4iej_A | 2e-22 | 24 | 109 | 4 | 93 | DNA methyltransferase 1-associated protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024966509.1 | 4e-94 | SWR1-complex protein 4 isoform X1 | ||||
Refseq | XP_024966511.1 | 3e-94 | SWR1-complex protein 4 isoform X3 | ||||
Swissprot | Q8VZL6 | 7e-80 | SWC4_ARATH; SWR1-complex protein 4 | ||||
TrEMBL | A0A2U1PEC9 | 1e-100 | A0A2U1PEC9_ARTAN; Myb-like transcription factor family protein | ||||
STRING | XP_010241543.1 | 2e-91 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47210.1 | 3e-82 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|