![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G51860.1 | ||||||||
Common Name | AGL72, MJM18.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 211aa MW: 24633.8 Da PI: 10.1776 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.3 | 8.5e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rqvtfskRr g++KKA+ELSvLCda+va +ifs++g+lye++s AT5G51860.1 9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAMIFSQKGRLYEFAS 59 68***********************************************86 PP | |||||||
2 | K-box | 59.5 | 1.4e-20 | 85 | 170 | 11 | 96 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 e+ + l++e+ + k+ie L+ +R+++G++L+s+s+keL ++ +q+eksl +R +K +l+ +++++l+ ke+el++e +L+ AT5G51860.1 85 EQYVQGLKKEMVTMVKKIEVLEVHNRKMMGQSLDSCSVKELSEIATQIEKSLHMVRLRKAKLYEDELQKLKAKERELKDERVRLSL 170 56678999**************999*******************************************************998875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.357 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.8E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.1E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.18E-39 | 3 | 73 | No hit | No description |
SuperFamily | SSF55455 | 9.68E-31 | 3 | 87 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.1E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.1E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.883 | 88 | 187 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.3E-19 | 89 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0005660 | anatomy | hydathode | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009049 | anatomy | inflorescence | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0009072 | anatomy | plant ovary | ||||
PO:0020121 | anatomy | lateral root | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAMIFSQ KGRLYEFASS 60 DIRNTIKRYA EYKREYFVAE THPIEQYVQG LKKEMVTMVK KIEVLEVHNR KMMGQSLDSC 120 SVKELSEIAT QIEKSLHMVR LRKAKLYEDE LQKLKAKERE LKDERVRLSL KKTIYTHLCQ 180 VGERPMGMPS GSKEKEDVET DLFIGFLKNR P |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 248373_at | 0.0 | ||||
Expression Atlas | AT5G51860 | - | ||||
AtGenExpress | AT5G51860 | - | ||||
ATTED-II | AT5G51860 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G51860.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT1G48150 | |||||
IntAct | Search Q9FLH5 |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:21609362}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G51860 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY141221 | 0.0 | AY141221.1 Arabidopsis thaliana MADS-box protein AGL72 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_199999.1 | 1e-154 | K-box region and MADS-box transcription factor family protein | ||||
Swissprot | Q9FLH5 | 1e-155 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | A0A178UL76 | 1e-141 | A0A178UL76_ARATH; AGL72 | ||||
STRING | AT5G51860.1 | 1e-153 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 | Representative plant | OGRP16 | 17 | 761 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G51860.1 |
Entrez Gene | 835261 |
iHOP | AT5G51860 |
wikigenes | AT5G51860 |