PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G45980.1
Common NameK15I22.18, STPL, WOX8, WOX9B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 325aa    MW: 36311.7 Da    PI: 6.3463
Description WUSCHEL related homeobox 8
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G45980.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.8e-1853113257
                  T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  ++R+++++eq+++Le+ F++ + +p +ee++++  +l    ++ +++V++WFqNr+ + k+
  AT5G45980.1  53 KPRWNPKPEQIRILESIFNSgTINPPREEIQRIRIRLqeygQIGDANVFYWFQNRKSRAKH 113
                  89*****************99*************************************995 PP

2Wus_type_Homeobox109.42.1e-3552114264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+ +P++eeiqri+ +L+eyG+i+d+NVfyWFQNrk+R ++k
        AT5G45980.1  52 PKPRWNPKPEQIRILESIFNSGTINPPREEIQRIRIRLQEYGQIGDANVFYWFQNRKSRAKHK 114
                        579**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.46349114IPR001356Homeobox domain
SuperFamilySSF466892.78E-1250116IPR009057Homeodomain-like
SMARTSM003897.2E-851118IPR001356Homeobox domain
CDDcd000862.57E-852114No hitNo description
PfamPF000461.6E-1553113IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-653113IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0030010Biological Processestablishment of cell polarity
GO:0048825Biological Processcotyledon development
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000001anatomyplant embryo proper
PO:0000199anatomycellular endosperm
PO:0000423anatomyplant zygote
PO:0002002anatomyembryo basal cell
PO:0020090anatomyembryo sac central cell
PO:0020094anatomyplant egg cell
PO:0020108anatomysuspensor
PO:0020109anatomyembryo hypophysis
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MSSSNKNWPS MFKSKPCNNN HHHQHEIDTP SYMHYSNCNL SSSFSSDRIP DPKPRWNPKP  60
EQIRILESIF NSGTINPPRE EIQRIRIRLQ EYGQIGDANV FYWFQNRKSR AKHKLRVHHK  120
SPKMSKKDKT VIPSTDADHC FGFVNQETGL YPVQNNELVV TEPAGFLFPV HNDPSAAQSA  180
FGFGDFVVPV VTEEGMAFST VNNGVNLETN ENFDKIPAIN LYGGDGNGGG NCFPPLTVPL  240
TINQSQEKRD VGLSGGEDVG DNVYPVRMTV FINEMPIEVV SGLFNVKAAF GNDAVLINSF  300
GQPILTDEFG VTYQPLQNGA IYYLI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.231550.0silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO795303920.0
Genevisible248922_at0.0
Expression AtlasAT5G45980-
AtGenExpressAT5G45980-
ATTED-IIAT5G45980-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the egg cell and the central cell of the embryo sac (PubMed:14711878). After fertilization, it is expressed in the zygote (PubMed:14711878). After the first division of the zygote, it is detected exclusively in the basal daughter cell, while WOX2 is expressed in the apical daughter cell (PubMed:14711878). Through the 16-cell stage, it is expressed in all descendants of the basal daughter, the developing suspensor and the hypophyseal cell (PubMed:14711878). After the hypophysis had divided, expression stops in descendants, but remains present in the extra embryonic suspensor (PubMed:14711878). Moreover it is found in the cellularized endosperm of the micropylar region during the globular and heart stages of embryogenesis (PubMed:14711878). Not expressed later in embryogenesis or in postembryonic stages (PubMed:14711878). Activated in the zygote after fertilization (PubMed:21316593). {ECO:0000269|PubMed:14711878, ECO:0000269|PubMed:21316593}.
UniprotTISSUE SPECIFICITY: Expressed only in the egg cell (PubMed:21316593). Not detected in the pollen tube (PubMed:21316593). Expressed in the zygote, the basal cell, and later the suspensor (PubMed:21802295). Expressed in all suspensor cells, except the hypophysis, and in the embryo surrounding region (ESR) endosperm cells (PubMed:22427333). Strongly expressed in the suspensor cells, with a weak expression also detected throughout the developing embryo (PubMed:22827849). {ECO:0000269|PubMed:21316593, ECO:0000269|PubMed:21802295, ECO:0000269|PubMed:22427333, ECO:0000269|PubMed:22827849}.
Functional Description ? help Back to Top
Source Description
TAIRArabidopsis thaliana WOX8 protein. Contains similarity to homeodomain transcription factor. Positively regulates early embryonic growth.
UniProtProbable transcription factor, which may be involved in embryonic patterning (PubMed:14711878). May be required for basal embryo development after fertilization (PubMed:14711878). Acts partially redundantly with STIP in promoting embryonic cell division and proliferation (PubMed:17706632). Promotes cotyledon boundary formation by maintaining the symmetry in CUC genes expression domains (PubMed:22827849). {ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:22827849, ECO:0000303|PubMed:14711878}.
Function -- GeneRIF ? help Back to Top
  1. combinatorial action of WOX transcription factors is essential for Arabidopsis embryonic development.
    [PMID: 17706632]
  2. Differential expression of WOX8 gene mediates apical-basal axis formation in the Arabidopsis embryo.
    [PMID: 18539115]
  3. Expression of WOX8 is independent of the axis patterning signal auxin, but, together with the redundant gene WOX9, is activated in the zygote, its basal daughter cell, and the hypophysis by the zinc-finger transcription factor WRKY2.
    [PMID: 21316593]
  4. CLE8 positively regulates expression of the WUS-related gene WOX8.
    [PMID: 22427333]
  5. Loss of WOX2 and WOX8 lead to the development of partially fused cotyledons.
    [PMID: 22827849]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G45980.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2 (PubMed:21316593). Up-regulated by CLE8 (PubMed:22427333). {ECO:0000269|PubMed:21316593, ECO:0000269|PubMed:22427333}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G17950(A), AT3G11260(A), AT5G59340(A)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype, due to the redundancy with WOX9 (PubMed:17706632). Wox8 and wox9 double mutants are embryo lethal, with embryos disrupted as early as the first cell division in the embryo proper (PubMed:17706632). {ECO:0000269|PubMed:17706632}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G45980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514000.0AY251400.1 Arabidopsis thaliana WOX8 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199410.20.0WUSCHEL related homeobox 8
SwissprotQ6X7J50.0WOX8_ARATH; WUSCHEL-related homeobox 8
TrEMBLA0A178UI570.0A0A178UI57_ARATH; WOX9B
STRINGAT5G45980.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142621619
Representative plantOGRP61031220
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. R
    Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes.
    Plant J., 2002. 32(2): p. 243-53
    [PMID:12383089]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  5. Hilson P, et al.
    Versatile gene-specific sequence tags for Arabidopsis functional genomics: transcript profiling and reverse genetics applications.
    Genome Res., 2004. 14(10B): p. 2176-89
    [PMID:15489341]
  6. Xiao W, et al.
    DNA methylation is critical for Arabidopsis embryogenesis and seed viability.
    Plant Cell, 2006. 18(4): p. 805-14
    [PMID:16531498]
  7. Wu X,Chory J,Weigel D
    Combinations of WOX activities regulate tissue proliferation during Arabidopsis embryonic development.
    Dev. Biol., 2007. 309(2): p. 306-16
    [PMID:17706632]
  8. Breuninger H,Rikirsch E,Hermann M,Ueda M,Laux T
    Differential expression of WOX genes mediates apical-basal axis formation in the Arabidopsis embryo.
    Dev. Cell, 2008. 14(6): p. 867-76
    [PMID:18539115]
  9. Rebocho AB, et al.
    Role of EVERGREEN in the development of the cymose petunia inflorescence.
    Dev. Cell, 2008. 15(3): p. 437-47
    [PMID:18804438]
  10. Nardmann J,Reisewitz P,Werr W
    Discrete shoot and root stem cell-promoting WUS/WOX5 functions are an evolutionary innovation of angiosperms.
    Mol. Biol. Evol., 2009. 26(8): p. 1745-55
    [PMID:19387013]
  11. Palovaara J,Hakman I
    WOX2 and polar auxin transport during spruce embryo pattern formation.
    Plant Signal Behav, 2009. 4(2): p. 153-5
    [PMID:19649198]
  12. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  13. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  14. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  15. Ueda M,Zhang Z,Laux T
    Transcriptional activation of Arabidopsis axis patterning genes WOX8/9 links zygote polarity to embryo development.
    Dev. Cell, 2011. 20(2): p. 264-70
    [PMID:21316593]
  16. Jeong S,Palmer TM,Lukowitz W
    The RWP-RK factor GROUNDED promotes embryonic polarity by facilitating YODA MAP kinase signaling.
    Curr. Biol., 2011. 21(15): p. 1268-76
    [PMID:21802295]
  17. Fiume E,Fletcher JC
    Regulation of Arabidopsis embryo and endosperm development by the polypeptide signaling molecule CLE8.
    Plant Cell, 2012. 24(3): p. 1000-12
    [PMID:22427333]
  18. Lie C,Kelsom C,Wu X
    WOX2 and STIMPY-LIKE/WOX8 promote cotyledon boundary formation in Arabidopsis.
    Plant J., 2012. 72(4): p. 674-82
    [PMID:22827849]
  19. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  20. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce.
    J. Exp. Bot., 2014. 65(22): p. 6543-52
    [PMID:25205582]
  21. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  22. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]