PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G45980.1 | ||||||||
Common Name | K15I22.18, STPL, WOX8, WOX9B | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 325aa MW: 36311.7 Da PI: 6.3463 | ||||||||
Description | WUSCHEL related homeobox 8 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 56 | 6.8e-18 | 53 | 113 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++R+++++eq+++Le+ F++ + +p +ee++++ +l ++ +++V++WFqNr+ + k+ AT5G45980.1 53 KPRWNPKPEQIRILESIFNSgTINPPREEIQRIRIRLqeygQIGDANVFYWFQNRKSRAKH 113 89*****************99*************************************995 PP | |||||||
2 | Wus_type_Homeobox | 109.4 | 2.1e-35 | 52 | 114 | 2 | 64 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 +++RW+P+peQi+iLe++++sG+ +P++eeiqri+ +L+eyG+i+d+NVfyWFQNrk+R ++k AT5G45980.1 52 PKPRWNPKPEQIRILESIFNSGTINPPREEIQRIRIRLQEYGQIGDANVFYWFQNRKSRAKHK 114 579**********************************************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 10.463 | 49 | 114 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.78E-12 | 50 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 7.2E-8 | 51 | 118 | IPR001356 | Homeobox domain |
CDD | cd00086 | 2.57E-8 | 52 | 114 | No hit | No description |
Pfam | PF00046 | 1.6E-15 | 53 | 113 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-6 | 53 | 113 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008284 | Biological Process | positive regulation of cell proliferation | ||||
GO:0030010 | Biological Process | establishment of cell polarity | ||||
GO:0048825 | Biological Process | cotyledon development | ||||
GO:0090451 | Biological Process | cotyledon boundary formation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000001 | anatomy | plant embryo proper | ||||
PO:0000199 | anatomy | cellular endosperm | ||||
PO:0000423 | anatomy | plant zygote | ||||
PO:0002002 | anatomy | embryo basal cell | ||||
PO:0020090 | anatomy | embryo sac central cell | ||||
PO:0020094 | anatomy | plant egg cell | ||||
PO:0020108 | anatomy | suspensor | ||||
PO:0020109 | anatomy | embryo hypophysis | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 325 aa Download sequence Send to blast |
MSSSNKNWPS MFKSKPCNNN HHHQHEIDTP SYMHYSNCNL SSSFSSDRIP DPKPRWNPKP 60 EQIRILESIF NSGTINPPRE EIQRIRIRLQ EYGQIGDANV FYWFQNRKSR AKHKLRVHHK 120 SPKMSKKDKT VIPSTDADHC FGFVNQETGL YPVQNNELVV TEPAGFLFPV HNDPSAAQSA 180 FGFGDFVVPV VTEEGMAFST VNNGVNLETN ENFDKIPAIN LYGGDGNGGG NCFPPLTVPL 240 TINQSQEKRD VGLSGGEDVG DNVYPVRMTV FINEMPIEVV SGLFNVKAAF GNDAVLINSF 300 GQPILTDEFG VTYQPLQNGA IYYLI |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.23155 | 0.0 | silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 79530392 | 0.0 | ||||
Genevisible | 248922_at | 0.0 | ||||
Expression Atlas | AT5G45980 | - | ||||
AtGenExpress | AT5G45980 | - | ||||
ATTED-II | AT5G45980 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the egg cell and the central cell of the embryo sac (PubMed:14711878). After fertilization, it is expressed in the zygote (PubMed:14711878). After the first division of the zygote, it is detected exclusively in the basal daughter cell, while WOX2 is expressed in the apical daughter cell (PubMed:14711878). Through the 16-cell stage, it is expressed in all descendants of the basal daughter, the developing suspensor and the hypophyseal cell (PubMed:14711878). After the hypophysis had divided, expression stops in descendants, but remains present in the extra embryonic suspensor (PubMed:14711878). Moreover it is found in the cellularized endosperm of the micropylar region during the globular and heart stages of embryogenesis (PubMed:14711878). Not expressed later in embryogenesis or in postembryonic stages (PubMed:14711878). Activated in the zygote after fertilization (PubMed:21316593). {ECO:0000269|PubMed:14711878, ECO:0000269|PubMed:21316593}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed only in the egg cell (PubMed:21316593). Not detected in the pollen tube (PubMed:21316593). Expressed in the zygote, the basal cell, and later the suspensor (PubMed:21802295). Expressed in all suspensor cells, except the hypophysis, and in the embryo surrounding region (ESR) endosperm cells (PubMed:22427333). Strongly expressed in the suspensor cells, with a weak expression also detected throughout the developing embryo (PubMed:22827849). {ECO:0000269|PubMed:21316593, ECO:0000269|PubMed:21802295, ECO:0000269|PubMed:22427333, ECO:0000269|PubMed:22827849}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Arabidopsis thaliana WOX8 protein. Contains similarity to homeodomain transcription factor. Positively regulates early embryonic growth. | |||||
UniProt | Probable transcription factor, which may be involved in embryonic patterning (PubMed:14711878). May be required for basal embryo development after fertilization (PubMed:14711878). Acts partially redundantly with STIP in promoting embryonic cell division and proliferation (PubMed:17706632). Promotes cotyledon boundary formation by maintaining the symmetry in CUC genes expression domains (PubMed:22827849). {ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:22827849, ECO:0000303|PubMed:14711878}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G45980.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2 (PubMed:21316593). Up-regulated by CLE8 (PubMed:22427333). {ECO:0000269|PubMed:21316593, ECO:0000269|PubMed:22427333}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT2G17950(A), AT3G11260(A), AT5G59340(A) |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: No visible phenotype, due to the redundancy with WOX9 (PubMed:17706632). Wox8 and wox9 double mutants are embryo lethal, with embryos disrupted as early as the first cell division in the embryo proper (PubMed:17706632). {ECO:0000269|PubMed:17706632}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G45980 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY251400 | 0.0 | AY251400.1 Arabidopsis thaliana WOX8 protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_199410.2 | 0.0 | WUSCHEL related homeobox 8 | ||||
Swissprot | Q6X7J5 | 0.0 | WOX8_ARATH; WUSCHEL-related homeobox 8 | ||||
TrEMBL | A0A178UI57 | 0.0 | A0A178UI57_ARATH; WOX9B | ||||
STRING | AT5G45980.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14262 | 16 | 19 |
Representative plant | OGRP6103 | 12 | 20 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G45980.1 |
Entrez Gene | 834638 |
iHOP | AT5G45980 |
wikigenes | AT5G45980 |