PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G39610.1
Common NameANAC092, ATNAC2, ATNAC6, MIJ24.11, NAC2, NAC6, NAC92, ORE1
Organism
Arabidopsis thaliana
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 285aa    MW: 32984.4 Da    PI: 5.9412
Description NAC domain containing protein 6
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G39610.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.93.3e-56201461129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yLk+kv ++ +++ ++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++
  AT5G39610.1  20 LPPGFRFHPTDEELITHYLKPKVFNTFFSA-TAIGEVDLNKIEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFK-GKS 115
                  79*************************999.88***************888999****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfykgrapkg+kt+Wvmheyrle
  AT5G39610.1 116 LVGMKKTLVFYKGRAPKGVKTNWVMHEYRLE 146
                  *****************************85 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-6416170IPR003441NAC domain
PROSITE profilePS5100559.69320170IPR003441NAC domain
PfamPF023656.7E-3021145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0010029Biological Processregulation of seed germination
GO:0042542Biological Processresponse to hydrogen peroxide
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048527Biological Processlateral root development
GO:0051091Biological Processpositive regulation of sequence-specific DNA binding transcription factor activity
GO:0090400Biological Processstress-induced premature senescence
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1902074Biological Processresponse to salt
GO:1904250Biological Processpositive regulation of age-related resistance
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MDYEASRIVE MVEDEEHIDL PPGFRFHPTD EELITHYLKP KVFNTFFSAT AIGEVDLNKI  60
EPWDLPWKAK MGEKEWYFFC VRDRKYPTGL RTNRATEAGY WKATGKDKEI FKGKSLVGMK  120
KTLVFYKGRA PKGVKTNWVM HEYRLEGKYC IENLPQTAKN EWVICRVFQK RADGTKVPMS  180
MLDPHINRME PAGLPSLMDC SQRDSFTGSS SHVTCFSDQE TEDKRLVHES KDGFGSLFYS  240
DPLFLQDNYS LMKLLLDGQE TQFSGKPFDG RDSSGTEELD CVWNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-541717614171NO APICAL MERISTEM PROTEIN
1ut4_B6e-541717614171NO APICAL MERISTEM PROTEIN
1ut7_A6e-541717614171NO APICAL MERISTEM PROTEIN
1ut7_B6e-541717614171NO APICAL MERISTEM PROTEIN
3swm_A6e-541717617174NAC domain-containing protein 19
3swm_B6e-541717617174NAC domain-containing protein 19
3swm_C6e-541717617174NAC domain-containing protein 19
3swm_D6e-541717617174NAC domain-containing protein 19
3swp_A6e-541717617174NAC domain-containing protein 19
3swp_B6e-541717617174NAC domain-containing protein 19
3swp_C6e-541717617174NAC domain-containing protein 19
3swp_D6e-541717617174NAC domain-containing protein 19
4dul_A6e-541717614171NAC domain-containing protein 19
4dul_B6e-541717614171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.244900.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible249467_at0.0
Expression AtlasAT5G39610-
AtGenExpressAT5G39610-
ATTED-IIAT5G39610-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates during leaf and flower aging (PubMed:20113437). Induced by EIN2 during leaf aging, but negatively regulated by miR164, which expression decreases gradually with aging through negative regulation by EIN2 (PubMed:19229035). In leaves, accumulates at the tips and margins and in leaves undergoing senescence. Present in floral organs of partly or fully opened flowers, but not in young flower buds. Expressed in pollen grains of mature anthers, but not in immature anthers. In petals of open flowers mostly observed in the tip region. In mature siliques, accumulates at the abscission zone, in the distal portion of the valve margins and the tip. In roots, detected in primary and lateral roots, but not in root tips. In seeds present in embryos and the micropylar endosperm (PubMed:20113437, PubMed:23340744). {ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:23340744}.
UniprotTISSUE SPECIFICITY: Mostly expressed in roots and flowers, and, to a lower extent, in shoots and leaves. Particularly expressed in old and senescing tissues. {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:23340744}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a NAC-domain transcription factor. Positively regulates aging-induced cell death and senescence in leaves. This gene is upregulated in response to salt stress in wildtype as well as NTHK1 transgenic lines although in the latter case the induction was drastically reduced. It was also upregulated by ABA, ACC and NAA treatment, although in the latter two cases, the induction occurred relatively late when compared with NaCl or ABA treatments. Note: this protein (AtNAC6) on occasion has also been referred to as AtNAC2, not to be confused with the AtNAC2 found at locus AT3G15510.
UniProtTranscription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269|PubMed:15295076, ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:21303842, ECO:0000269|PubMed:23340744, ECO:0000269|PubMed:23459204, ECO:0000269|PubMed:9351240}.
Function -- GeneRIF ? help Back to Top
  1. ORE1(At5g39610) positively regulates aging-induced cell death; expression is upregulated with leaf aging by EIN2 but negatively regulated by miR164; feed-forward pathway involving ORE1, miR164 & EIN2 provides regulation ensuring aging induces cell death
    [PMID: 19229035]
  2. BIFUNCTIONAL NUCLEASE1 (BFN1), a well-known senescence-enhanced gene, is directly regulated by ORE1.
    [PMID: 23340744]
  3. ORE1 interacts with the G2-like transcription factors GLK1 and GLK2, which are important for chloroplast development and maintenance.
    [PMID: 23459204]
  4. ANAC092 is involved in regulation of anther development.
    [PMID: 23853363]
  5. the ore1 loss-of-function mutants were epistatic to nes1, suggesting the dominant role of ORE1 and the antagonistic role of NES1 during nitric oxide-induced cotyledon senescence in Arabidopsis.
    [PMID: 24336389]
  6. EIN3, ORE1 and chlorophyll catabolic genes constitute a coherent feed-forward loop involving in the robust regulation of ethylene-mediated chlorophyll degradation during leaf senescence in Arabidopsis.
    [PMID: 26218222]
  7. Authors identified the leaf senescence regulator ORESARA1 (also known as ANAC092) and the previously uncharacterized KIRA1 (also known as ANAC074) as partially redundant transcription factors that modulate stigma longevity by controlling the expression of programmed cell death-associated genes. [ORESARA1]
    [PMID: 29808023]
  8. PRR9, a core circadian component, is a key regulator of leaf senescence via positive regulation of ORE1 through a feed-forward pathway involving posttranscriptional regulation by miR164 and direct transcriptional regulation.
    [PMID: 30065116]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00535DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G39610.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19608714, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:20404534, ECO:0000269|PubMed:21511905, ECO:0000269|PubMed:22930749}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G44190, AT1G69490
IntActSearch Q9FKA0
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype (PubMed:16359384). Delayed leaf senescence and flowering (PubMed:9351240, PubMed:19229035, PubMed:20113437, PubMed:21303842). Increased tolerance to various types of oxidative stress including H(2)O(2), salicylhydroxamic acid (SHAM), N,N-diethyldithio carbamic acid (DDC) and methyl viologen (MV) (PubMed:15295076). Impaired age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Increased seed germination rate under saline conditions and delay of salinity-induced chlorophyll loss in leaves (PubMed:20113437). {ECO:0000269|PubMed:15295076, ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:21303842, ECO:0000269|PubMed:9351240}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G39610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0563270.0AY056327.1 Arabidopsis thaliana putative NAM / CUC2 protein (At5g39610) mRNA, complete cds.
GenBankAY0846350.0AY084635.1 Arabidopsis thaliana clone 113779 mRNA, complete sequence.
GenBankAY0911910.0AY091191.1 Arabidopsis thaliana putative NAM/CUC2 protein (At5g39610) mRNA, complete cds.
GenBankAY1741630.0AY174163.1 Arabidopsis thaliana ecotype Columbia no apical meristem-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198777.10.0NAC domain containing protein 6
SwissprotQ9FKA00.0NAC92_ARATH; NAC domain-containing protein 92
TrEMBLA0A178UPA60.0A0A178UPA6_ARATH; ORE1
STRINGAT5G39610.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Woo HR,Kim JH,Nam HG,Lim PO
    The delayed leaf senescence mutants of Arabidopsis, ore1, ore3, and ore9 are tolerant to oxidative stress.
    Plant Cell Physiol., 2004. 45(7): p. 923-32
    [PMID:15295076]
  5. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  6. He XJ, et al.
    AtNAC2, a transcription factor downstream of ethylene and auxin signaling pathways, is involved in salt stress response and lateral root development.
    Plant J., 2005. 44(6): p. 903-16
    [PMID:16359384]
  7. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  8. Kim JH, et al.
    Trifurcate feed-forward regulation of age-dependent cell death involving miR164 in Arabidopsis.
    Science, 2009. 323(5917): p. 1053-7
    [PMID:19229035]
  9. Chen T, et al.
    Effects of tobacco ethylene receptor mutations on receptor kinase activity, plant growth and stress responses.
    Plant Cell Physiol., 2009. 50(9): p. 1636-50
    [PMID:19608714]
  10. Carviel JL, et al.
    Forward and reverse genetics to identify genes involved in the age-related resistance response in Arabidopsis thaliana.
    Mol. Plant Pathol., 2009. 10(5): p. 621-34
    [PMID:19694953]
  11. Balazadeh S, et al.
    A gene regulatory network controlled by the NAC transcription factor ANAC092/AtNAC2/ORE1 during salt-promoted senescence.
    Plant J., 2010. 62(2): p. 250-64
    [PMID:20113437]
  12. Balazadeh S,Wu A,Mueller-Roeber B
    Salt-triggered expression of the ANAC092-dependent senescence regulon in Arabidopsis thaliana.
    Plant Signal Behav, 2010. 5(6): p. 733-5
    [PMID:20404534]
  13. Balazadeh S, et al.
    ORS1, an H₂O₂-responsive NAC transcription factor, controls senescence in Arabidopsis thaliana.
    Mol Plant, 2011. 4(2): p. 346-60
    [PMID:21303842]
  14. Kim JI, et al.
    YUCCA6 over-expression demonstrates auxin function in delaying leaf senescence in Arabidopsis thaliana.
    J. Exp. Bot., 2011. 62(11): p. 3981-92
    [PMID:21511905]
  15. Hur Y,Kim JH,Lee DJ,Chung KM,Woo HR
    Overexpression of AtCHX24, a member of the cation/H⁺ exchangers, accelerates leaf senescence in Arabidopsis thaliana.
    Plant Sci., 2012. 183: p. 175-82
    [PMID:22195591]
  16. Vogelmann K, et al.
    Early senescence and cell death in Arabidopsis saul1 mutants involves the PAD4-dependent salicylic acid pathway.
    Plant Physiol., 2012. 159(4): p. 1477-87
    [PMID:22706448]
  17. Trivellini A, et al.
    Carbon deprivation-driven transcriptome reprogramming in detached developmentally arresting Arabidopsis inflorescences.
    Plant Physiol., 2012. 160(3): p. 1357-72
    [PMID:22930749]
  18. Renault H, et al.
    γ-Aminobutyric acid transaminase deficiency impairs central carbon metabolism and leads to cell wall defects during salt stress in Arabidopsis roots.
    Plant Cell Environ., 2013. 36(5): p. 1009-18
    [PMID:23148892]
  19. Matallana-Ramirez LP, et al.
    NAC transcription factor ORE1 and senescence-induced BIFUNCTIONAL NUCLEASE1 (BFN1) constitute a regulatory cascade in Arabidopsis.
    Mol Plant, 2013. 6(5): p. 1438-52
    [PMID:23340744]
  20. Rauf M, et al.
    ORE1 balances leaf senescence against maintenance by antagonizing G2-like-mediated transcription.
    EMBO Rep., 2013. 14(4): p. 382-8
    [PMID:23459204]
  21. Li J,Chen X,Luo LQ,Yu J,Ming F
    [Functions of ANAC092 involved in regulation of anther development in Arabidopsis thaliana].
    Yi Chuan, 2013. 35(7): p. 913-22
    [PMID:23853363]
  22. Pei H, et al.
    An NAC transcription factor controls ethylene-regulated cell expansion in flower petals.
    Plant Physiol., 2013. 163(2): p. 775-91
    [PMID:23933991]
  23. Manacorda CA, et al.
    Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes.
    Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98
    [PMID:23945002]
  24. Khan M,Rozhon W,Poppenberger B
    The role of hormones in the aging of plants - a mini-review.
    Gerontology, 2014. 60(1): p. 49-55
    [PMID:24135638]
  25. Du J, et al.
    Nitric oxide induces cotyledon senescence involving co-operation of the NES1/MAD1 and EIN2-associated ORE1 signalling pathways in Arabidopsis.
    J. Exp. Bot., 2014. 65(14): p. 4051-63
    [PMID:24336389]
  26. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  27. Kim HJ, et al.
    Gene regulatory cascade of senescence-associated NAC transcription factors activated by ETHYLENE-INSENSITIVE2-mediated leaf senescence signalling in Arabidopsis.
    J. Exp. Bot., 2014. 65(14): p. 4023-36
    [PMID:24659488]
  28. Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N
    Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast.
    Plant J., 2015. 81(3): p. 377-87
    [PMID:25440717]
  29. Qiu K, et al.
    EIN3 and ORE1 Accelerate Degreening during Ethylene-Mediated Leaf Senescence by Directly Activating Chlorophyll Catabolic Genes in Arabidopsis.
    PLoS Genet., 2015. 11(7): p. e1005399
    [PMID:26218222]
  30. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  31. Gao Z, et al.
    KIRA1 and ORESARA1 terminate flower receptivity by promoting cell death in the stigma of Arabidopsis.
    Nat Plants, 2018. 4(6): p. 365-375
    [PMID:29808023]
  32. Kim H, et al.
    Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453
    [PMID:30065116]
  33. Oh SA, et al.
    Identification of three genetic loci controlling leaf senescence in Arabidopsis thaliana.
    Plant J., 1997. 12(3): p. 527-35
    [PMID:9351240]