PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB_related

Protein Properties

Length: 287aa MW: 32436.4 Da PI: 7.5403

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G37260.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.3	2.6e-16	36	80	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT+ E+e++v+a k++G W++I +++g ++t+ q++s+ qk+ AT5G37260.1 36 REKWTEAEHEKFVEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 80 789***************88.*****.**********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	8.97E-16	30	84	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.705	31	85	IPR017930	Myb domain
TIGRFAMs	TIGR01557	1.4E-16	34	83	IPR006447	Myb domain, plants
SMART	SM00717	1.6E-12	35	83	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.6E-9	36	76	IPR009057	Homeodomain-like
Pfam	PF00249	1.6E-13	36	79	IPR001005	SANT/Myb domain
CDD	cd00167	2.30E-9	38	81	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0007623	Biological Process	circadian rhythm
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0009845	Biological Process	seed germination
GO:0009909	Biological Process	regulation of flower development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 287 aa Download sequence Send to blast
MAMQERCESL CSDELISSSD AFYLKTRKPY TITKQREKWT EAEHEKFVEA LKLYGRAWRR 60 IEEHVGTKTA VQIRSHAQKF FTKVARDFGV SSESIEIPPP RPKRKPMHPY PRKLVIPDAK 120 EMVYAELTGS KLIQDEDNRS PTSVLSAHGS DGLGSIGSNS PNSSSAELSS HTEESLSLEA 180 ETKQSLKLFG KTFVVGDYNS SMSCDDSEDG KKKLYSETQS LQCSSSTSEN AETEVVVSEF 240 KRSERSAFSQ LKSSVTEMNN MRGFMPYKKR VKVEENIDNV KLSYPLW

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.30502	0.0	root\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	249606_at	0.0
Expression Atlas	AT5G37260	-
AtGenExpress	AT5G37260	-
ATTED-II	AT5G37260	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a MYB family transcription factor Circadian 1 (CIR1). Involved in circadian regulation in Arabidopsis.
UniProt	Positive regulator for cold-responsive gene expression and cold tolerance. Part of a regulatory feedback loop that controls a subset of the circadian outputs and modulates the central oscillator. Negatively self-regulates its own expression. {ECO:0000269\|PubMed:17587236, ECO:0000269\|PubMed:23371945}.

Function -- GeneRIF ? help Back to Top
CIR1 is possibly part of a regulatory feedback loop that controls a subset of the circadian outputs and modulates the central oscillator.[CIR1] [Circadian 1] [PMID: 17587236] RVE1 and RVE2 transcription factors promote primary seed dormancy and repress red/far-red-light-reversible germination downstream of phytochrome B (phyB) in Arabidopsis thaliana. RVE1 and RVE2 expression is downregulated after imbibition and by phyB. [PMID: 27506149]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G37260.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Up-regulated transiently by light. {ECO:0000269\|PubMed:17587236, ECO:0000269\|PubMed:19805390}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G01060(R), AT1G65480(R), AT2G46830(R), AT5G15840(R)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G37260, AT5G54230, AT1G10585, AT1G77450

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: No effect on the regulation of core clock associated genes or on the hypocotyl length, but hypersensitivity to freezing stress and slightly earlier-flowering phenotype. Rve1 and rve2 double mutant has no alteration in the period or phase of the clock. Rve1, rve2 and rve7 triple mutant has no alteration in the period or phase of the clock. {ECO:0000269\|PubMed:17587236, ECO:0000269\|PubMed:19805390, ECO:0000269\|PubMed:23371945}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G37260

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519515	0.0	AY519515.1 Arabidopsis thaliana MYB transcription factor (At5g37260) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_198542.1	0.0	Homeodomain-like superfamily protein
Swissprot	F4K5X6	0.0	RVE2_ARATH; Protein REVEILLE 2
TrEMBL	A0A178UB19	0.0	A0A178UB19_ARATH; RVE2
STRING	AT5G37260.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM14432	19	22
Representative plant	OGRP1255	15	49

Link Out ? help Back to Top
Phytozome	AT5G37260.1
Entrez Gene	833700
iHOP	AT5G37260
wikigenes	AT5G37260

Publications ? help Back to Top
Chaudhury A,Okada K,Raikhel NV,Shinozaki K,Sundaresan V V A weed reaches new heights down under Plant Cell, 1999. 11(10): p. 1817-26 [PMID:10521514] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Kasukabe Y, et al. Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana. Plant Cell Physiol., 2004. 45(6): p. 712-22 [PMID:15215506] Mockler TC, et al. Regulation of flowering time in Arabidopsis by K homology domain proteins. Proc. Natl. Acad. Sci. U.S.A., 2004. 101(34): p. 12759-64 [PMID:15310842] Vergnolle C, et al. The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions. Plant Physiol., 2005. 139(3): p. 1217-33 [PMID:16258011] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Knight CA, et al. Expression profiling and local adaptation of Boechera holboellii populations for water use efficiency across a naturally occurring water stress gradient. Mol. Ecol., 2006. 15(5): p. 1229-37 [PMID:16626450] Khanna R, et al. Functional profiling reveals that only a small number of phytochrome-regulated early-response genes in Arabidopsis are necessary for optimal deetiolation. Plant Cell, 2006. 18(9): p. 2157-71 [PMID:16891401] Osuna D, et al. Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings. Plant J., 2007. 49(3): p. 463-91 [PMID:17217462] Lou Y,Gou JY,Xue HW PIP5K9, an Arabidopsis phosphatidylinositol monophosphate kinase, interacts with a cytosolic invertase to negatively regulate sugar-mediated root growth. Plant Cell, 2007. 19(1): p. 163-81 [PMID:17220200] Tran LS, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis. Plant J., 2007. 49(1): p. 46-63 [PMID:17233795] Zhang X, et al. Constitutive expression of CIR1 (RVE2) affects several circadian-regulated processes and seed germination in Arabidopsis. Plant J., 2007. 51(3): p. 512-25 [PMID:17587236] Cai X, et al. A putative CCAAT-binding transcription factor is a regulator of flowering timing in Arabidopsis. Plant Physiol., 2007. 145(1): p. 98-105 [PMID:17631525] Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM Light has a specific role in modulating Arabidopsis gene expression at low temperature. BMC Plant Biol., 2008. 8: p. 13 [PMID:18230142] Usadel B, et al. Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes. Plant Physiol., 2008. 146(4): p. 1834-61 [PMID:18305208] L Knocking out cytosolic cysteine synthesis compromises the antioxidant capacity of the cytosol to maintain discrete concentrations of hydrogen peroxide in Arabidopsis. Plant Physiol., 2008. 147(2): p. 562-72 [PMID:18441224] Rawat R, et al. REVEILLE1, a Myb-like transcription factor, integrates the circadian clock and auxin pathways. Proc. Natl. Acad. Sci. U.S.A., 2009. 106(39): p. 16883-8 [PMID:19805390] Filichkin SA,Mockler TC Unproductive alternative splicing and nonsense mRNAs: a widespread phenomenon among plant circadian clock genes. Biol. Direct, 2012. 7: p. 20 [PMID:22747664] Guan Q, et al. A DEAD box RNA helicase is critical for pre-mRNA splicing, cold-responsive gene regulation, and cold tolerance in Arabidopsis. Plant Cell, 2013. 25(1): p. 342-56 [PMID:23371945] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Lumba S, et al. A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis. Dev. Cell, 2014. 29(3): p. 360-72 [PMID:24823379] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Jiang Z,Xu G,Jing Y,Tang W,Lin R Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis. Nat Commun, 2016. 7: p. 12377 [PMID:27506149]