 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
AT5G33210.2 |
| Common Name | SRS8 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
| Family |
SRS |
| Protein Properties |
Length: 106aa MW: 11737.3 Da PI: 10.5943 |
| Description |
SHI-related sequence 8 |
| Gene Model |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | DUF702 | 127.1 | 2e-39 | 11 | 103 | 2 | 94 |
DUF702 2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssa 94
+sg++sCqd GnqakkdC+h+RCRtCCksrgf+C+thv+stWvpa+krrerqqqla+ + +++ + e+ +kr+re+ +++s+l +t+++ +
AT5G33210.2 11 GSGGVSCQDFGNQAKKDCSHMRCRTCCKSRGFECSTHVRSTWVPATKRRERQQQLATVQPQTQLPRGESVPKRHRENLPATSSSLVCTRIPFH 103
57899*****************************************************99999999**********************99865 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| TAIR | A member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. SRS8 is a putative pseudogene. |
| UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM) (By similarity). {ECO:0000250}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AB046437 | 1e-176 | AB046437.1 Arabidopsis thaliana DNA, chromosome 5 centromere region, clone:F11B20. |
| GenBank | AC069557 | 1e-176 | AC069557.5 Genomic Sequence For Arabidopsis thaliana Clone T29A4 From Chromosome V, complete sequence. |
| GenBank | CP002688 | 1e-176 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
| Publications
? help Back to Top |
- Kuusk S,Sohlberg JJ,Long JA,Fridborg I,Sundberg E
STY1 and STY2 promote the formation of apical tissues during Arabidopsis gynoecium development.
Development, 2002. 129(20): p. 4707-17
[PMID:12361963] - Bailey PC, et al.
Update on the basic helix-loop-helix transcription factor gene family in Arabidopsis thaliana.
Plant Cell, 2003. 15(11): p. 2497-502
[PMID:14600211] - Rigola D,Fiers M,Vurro E,Aarts MG
The heavy metal hyperaccumulator Thlaspi caerulescens expresses many species-specific genes, as identified by comparative expressed sequence tag analysis.
New Phytol., 2006. 170(4): p. 753-65
[PMID:16684236] - Kuusk S,Sohlberg JJ,Magnus Eklund D,Sundberg E
Functionally redundant SHI family genes regulate Arabidopsis gynoecium development in a dose-dependent manner.
Plant J., 2006. 47(1): p. 99-111
[PMID:16740146]
|
