 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
AT5G26930.1 |
| Common Name | F2P16.190, F2P16.9, GATA23 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
| Family |
GATA |
| Protein Properties |
Length: 120aa MW: 13238.7 Da PI: 10.74 |
| Description |
GATA transcription factor 23 |
| Gene Model |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | GATA | 58 | 1.3e-18 | 28 | 62 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs C+ttkTp+WR gp g+k+LCnaCG+++rk+++
AT5G26930.1 28 CSECKTTKTPMWRGGPTGPKSLCNACGIRHRKQRR 62
********************************985 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0009416 | Biological Process | response to light stimulus |
| GO:0030154 | Biological Process | cell differentiation |
| GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter |
| GO:0048527 | Biological Process | lateral root development |
| GO:0005634 | Cellular Component | nucleus |
| GO:0005667 | Cellular Component | transcription factor complex |
| GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding |
| GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding |
| GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding |
| GO:0003682 | Molecular Function | chromatin binding |
| GO:0008270 | Molecular Function | zinc ion binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| TAIR | Encodes a member of the GATA factor family of zinc finger transcription factors. |
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
| Publications
? help Back to Top |
- Jeong MJ,Jeong MJ,Shih MC
Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
[PMID:12504119] - Reyes JC,Muro-Pastor MI,Florencio FJ
The GATA family of transcription factors in Arabidopsis and rice.
Plant Physiol., 2004. 134(4): p. 1718-32
[PMID:15084732] - Bi YM, et al.
Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
Plant J., 2005. 44(4): p. 680-92
[PMID:16262716] - AbuQamar S, et al.
Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection.
Plant J., 2006. 48(1): p. 28-44
[PMID:16925600] - Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
Plant Biotechnol. J., 2006. 4(3): p. 317-24
[PMID:17147637] - Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
Plant Physiol., 2007. 143(2): p. 941-58
[PMID:17208962] - De Rybel B, et al.
A novel aux/IAA28 signaling cascade activates GATA23-dependent specification of lateral root founder cell identity.
Curr. Biol., 2010. 20(19): p. 1697-706
[PMID:20888232] - Singh S,Singh A,Roy S,Sarkar AK
SWP1 negatively regulates lateral root initiation and elongation in Arabidopsis.
Plant Signal Behav, 2012. 7(12): p. 1522-5
[PMID:23073020] - Behringer C,Bastakis E,Ranftl QL,Mayer KF,Schwechheimer C
Functional diversification within the family of B-GATA transcription factors through the leucine-leucine-methionine domain.
Plant Physiol., 2014. 166(1): p. 293-305
[PMID:25077795] - Murphy E, et al.
RALFL34 regulates formative cell divisions in Arabidopsis pericycle during lateral root initiation.
J. Exp. Bot., 2016. 67(16): p. 4863-75
[PMID:27521602]
|
