PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

HD-ZIP

Protein Properties

Length: 314aa MW: 36282.1 Da PI: 6.8667

Description

homeobox 3

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G15150.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	56.1	6.1e-18	116	168	4	56
-SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 + +++ eq+++Le+ Fe +++ e++ +LAk lgL+ rq+ +WFqNrRa++k AT5G15150.1 116 KKRLNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 168 4568889*********************************************9 PP
2	HD-ZIP_I/II	128.4	3.1e-41	114	205	1	92
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 ekk+rl+ eqv++LE+sFe +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlE+dy++Lk+++d lk++n++L +++++L++el AT5G15150.1 114 EKKKRLNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYDSLKKQFDVLKSDNDSLLAHNKKLHAELV 205 69**************************************************************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	3.29E-19	106	172	IPR009057	Homeodomain-like
SMART	SM00389	2.6E-17	113	174	IPR001356	Homeobox domain
PROSITE profile	PS50071	16.552	114	170	IPR001356	Homeobox domain
CDD	cd00086	2.00E-16	115	171	No hit	No description
Pfam	PF00046	3.3E-15	116	168	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	4.0E-19	118	178	IPR009057	Homeodomain-like
PRINTS	PR00031	1.2E-5	141	150	IPR000047	Helix-turn-helix motif
PROSITE pattern	PS00027	0	145	168	IPR017970	Homeobox, conserved site
PRINTS	PR00031	1.2E-5	150	166	IPR000047	Helix-turn-helix motif
Pfam	PF02183	4.6E-15	170	209	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0000223	anatomy	shoot axis cortex
PO:0000258	anatomy	root cortex
PO:0009001	anatomy	fruit
PO:0009005	anatomy	root
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025257	anatomy	primary root elongation zone
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 314 aa Download sequence Send to blast
MYMYEEERNN INNNQEGLRL EMAFPQHGFM FQQLHEDNAH HLPSPTSLPS CPPHLFYGGG 60 GNYMMNRSMS FTGVSDHHHL TQKSPTTTNN MNDQDQVGEE DNLSDDGSHM MLGEKKKRLN 120 LEQVRALEKS FELGNKLEPE RKMQLAKALG LQPRQIAIWF QNRRARWKTK QLERDYDSLK 180 KQFDVLKSDN DSLLAHNKKL HAELVALKKH DRKESAKIKR EFAEASWSNN GSTENNHNNN 240 SSDANHVSMI KDLFPSSIRS ATATTTSTHI DHQIVQDQDQ GFCNMFNGID ETTSASYWAW 300 PDQQQQHHNH HQFN

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	162	170	RRARWKTKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.49022	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	250108_at	0.0
Expression Atlas	AT5G15150	-
AtGenExpress	AT5G15150	-
ATTED-II	AT5G15150	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed predominantly in flowers, and in the cortex of the root and the stem. {ECO:0000269\|PubMed:16055682}.

Functional Description ? help Back to Top
Source	Description
TAIR	homeobox-containing gene with an unusual feature: a leucine zipper motif adjacent to the carboxyl-terminal of the homeodomain structure. This gene is expressed primarily in the cortex of the root and the stem.
UniProt	Probable transcription factor. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G15150.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G15150

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK229364	0.0	AK229364.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL16-61-C06.
GenBank	BT044059	0.0	BT044059.1 Arabidopsis thaliana unknown protein (At5g15150) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_568309.2	0.0	homeobox 3
Swissprot	Q00466	0.0	HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBL	B5RID5	0.0	B5RID5_ARATH; At5g15150
STRING	AT5G15150.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3095	26	66
Representative plant	OGRP129	16	189

Link Out ? help Back to Top
Phytozome	AT5G15150.1
Entrez Gene	831367
iHOP	AT5G15150
wikigenes	AT5G15150

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Johannesson H,Wang Y,Engström P DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro. Plant Mol. Biol., 2001. 45(1): p. 63-73 [PMID:11247607] Hudson ME,Lisch DR,Quail PH The FHY3 and FAR1 genes encode transposase-related proteins involved in regulation of gene expression by the phytochrome A-signaling pathway. Plant J., 2003. 34(4): p. 453-71 [PMID:12753585] Mattsson J,S A new homeobox-leucine zipper gene from Arabidopsis thaliana. Plant Mol. Biol., 1992. 18(5): p. 1019-22 [PMID:1349836] Schmid M, et al. Dissection of floral induction pathways using global expression analysis. Development, 2003. 130(24): p. 6001-12 [PMID:14573523] Oh S,Park S,Han KH Transcriptional regulation of secondary growth in Arabidopsis thaliana. J. Exp. Bot., 2003. 54(393): p. 2709-22 [PMID:14585825] Henriksson E, et al. Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships. Plant Physiol., 2005. 139(1): p. 509-18 [PMID:16055682] Tan QK,Irish VF The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development. Plant Physiol., 2006. 140(3): p. 1095-108 [PMID:16428600] Saddic LA, et al. The LEAFY target LMI1 is a meristem identity regulator and acts together with LEAFY to regulate expression of CAULIFLOWER. Development, 2006. 133(9): p. 1673-82 [PMID:16554366] Roig-Villanova I,Bou J,Sorin C,Devlin PF,Martínez-García JF Identification of primary target genes of phytochrome signaling. Early transcriptional control during shade avoidance responses in Arabidopsis. Plant Physiol., 2006. 141(1): p. 85-96 [PMID:16565297] Lee JY, et al. Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots. Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60 [PMID:16581911] Mace DL, et al. Quantification of transcription factor expression from Arabidopsis images. Bioinformatics, 2006. 22(14): p. e323-31 [PMID:16873489] Cao D,Cheng H,Wu W,Soo HM,Peng J Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] Tahir M,Belmonte MF,Elhiti M,Flood H,Stasolla C Identification and characterization of PgHZ1, a novel homeodomain leucine-zipper gene isolated from white spruce (Picea glauca) tissue. Plant Physiol. Biochem., 2008. 46(12): p. 1031-9 [PMID:18848454] Schena M,Davis RW Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families. Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7 [PMID:7915839] S Expression patterns of novel genes encoding homeodomain leucine-zipper proteins in Arabidopsis thaliana. Plant Mol. Biol., 1994. 26(1): p. 145-54 [PMID:7948864]