PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WRKY

Protein Properties

Length: 216aa MW: 24784 Da PI: 10.2152

Description

WRKY DNA-binding protein 26

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G07100.2	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	103.2	1.4e-32	24	82	2	60
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 dDgynWrKYGqK+vkgse+prsY++Ct+++C +kkkve+s ++++ei+Y+g+Hnh+k AT5G07100.2 24 DDGYNWRKYGQKQVKGSENPRSYFKCTYPNCLTKKKVETSLVKGQMIEIVYKGSHNHPK 82 8********************************************************85 PP
2	WRKY	105.6	2.7e-33	140	198	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+ +dpk v++tYeg+H+h+ AT5G07100.2 140 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFTGCFVRKHVERAFQDPKSVITTYEGKHKHQ 198 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.0E-28	15	84	IPR003657	WRKY domain
SuperFamily	SSF118290	3.53E-26	18	83	IPR003657	WRKY domain
PROSITE profile	PS50811	24.857	18	83	IPR003657	WRKY domain
SMART	SM00774	7.1E-35	23	82	IPR003657	WRKY domain
Pfam	PF03106	2.0E-24	24	81	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	1.3E-36	125	200	IPR003657	WRKY domain
SuperFamily	SSF118290	3.53E-29	132	200	IPR003657	WRKY domain
PROSITE profile	PS50811	36.196	135	200	IPR003657	WRKY domain
SMART	SM00774	1.0E-36	140	199	IPR003657	WRKY domain
Pfam	PF03106	4.5E-25	141	198	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0070370	Biological Process	cellular heat acclimation
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009047	anatomy	stem
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl
PO:0025022	anatomy	collective leaf structure
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 216 aa Download sequence Send to blast
MVTQPLPQLD LFKSEIMSSN KTSDDGYNWR KYGQKQVKGS ENPRSYFKCT YPNCLTKKKV 60 ETSLVKGQMI EIVYKGSHNH PKPQSTKRSS STAIAAHQNS SNGDGKDIGE DETEAKRWKR 120 EENVKEPRVV VQTTSDIDIL DDGYRWRKYG QKVVKGNPNP RSYYKCTFTG CFVRKHVERA 180 FQDPKSVITT YEGKHKHQIP TPRRGPVLRL LGKTET

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	8e-37	24	201	8	78	Probable WRKY transcription factor 4
2lex_A	8e-37	24	201	8	78	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.5041	0.0	inflorescence\| leaf

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	250666_at	0.0
Expression Atlas	AT5G07100	-
AtGenExpress	AT5G07100	-
ATTED-II	AT5G07100	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes WRKY DNA-binding protein 26 (WRKY26).
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY25 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250\|UniProtKB:Q9SI37, ECO:0000269\|PubMed:21336597}.

Function -- GeneRIF ? help Back to Top
AtWRKY25 and AtWRKY26 were gradually induced during heat and cold treatments, whereas AtWRKY33 was suppressed by heat treatment and induced rapidly during cold stress. [PMID: 20709683]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00494	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G07100.2

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salicylic acid (PubMed:11449049). Induced by heat stress (PubMed:21336597). {ECO:0000269\|PubMed:11449049, ECO:0000269\|PubMed:21336597}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G32640 (R), AT2G38470 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G63650(R), AT3G55730(R), AT5G60890(R)

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G07100

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT026349	0.0	BT026349.1 Arabidopsis thaliana At5g07100 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001331975.1	1e-162	WRKY DNA-binding protein 26
Refseq	NP_001331976.1	1e-162	WRKY DNA-binding protein 26
Refseq	NP_001331977.1	1e-162	WRKY DNA-binding protein 26
Refseq	NP_196327.1	1e-161	WRKY DNA-binding protein 26
Refseq	NP_974746.1	1e-162	WRKY DNA-binding protein 26
Swissprot	Q9C5T3	1e-162	WRK26_ARATH; Probable WRKY transcription factor 26
TrEMBL	Q0V871	1e-160	Q0V871_ARATH; At5g07100
STRING	AT5G07100.1	1e-160	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT5G07100.2
Entrez Gene	830601
iHOP	AT5G07100
wikigenes	AT5G07100

Publications ? help Back to Top
Eulgem T,Rushton PJ,Robatzek S,Somssich IE The WRKY superfamily of plant transcription factors. Trends Plant Sci., 2000. 5(5): p. 199-206 [PMID:10785665] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yu D,Chen C,Chen Z Evidence for an important role of WRKY DNA binding proteins in the regulation of NPR1 gene expression. Plant Cell, 2001. 13(7): p. 1527-40 [PMID:11449049] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Sottosanto JB,Gelli A,Blumwald E DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression. Plant J., 2004. 40(5): p. 752-71 [PMID:15546358] Branco-Price C,Kawaguchi R,Ferreira RB,Bailey-Serres J Genome-wide analysis of transcript abundance and translation in Arabidopsis seedlings subjected to oxygen deprivation. Ann. Bot., 2005. 96(4): p. 647-60 [PMID:16081496] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Li Y, et al. Establishing glucose- and ABA-regulated transcription networks in Arabidopsis by microarray analysis and promoter classification using a Relevance Vector Machine. Genome Res., 2006. 16(3): p. 414-27 [PMID:16424108] Tosti N, et al. Gene expression profiles of O3-treated Arabidopsis plants. Plant Cell Environ., 2006. 29(9): p. 1686-702 [PMID:16913859] Osuna D, et al. Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings. Plant J., 2007. 49(3): p. 463-91 [PMID:17217462] Culligan KM,Robertson CE,Foreman J,Doerner P,Britt AB ATR and ATM play both distinct and additive roles in response to ionizing radiation. Plant J., 2006. 48(6): p. 947-61 [PMID:17227549] Dombrecht B, et al. MYC2 differentially modulates diverse jasmonate-dependent functions in Arabidopsis. Plant Cell, 2007. 19(7): p. 2225-45 [PMID:17616737] Zhang Z, et al. Dual regulation role of GH3.5 in salicylic acid and auxin signaling during Arabidopsis-Pseudomonas syringae interaction. Plant Physiol., 2007. 145(2): p. 450-64 [PMID:17704230] Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM Light has a specific role in modulating Arabidopsis gene expression at low temperature. BMC Plant Biol., 2008. 8: p. 13 [PMID:18230142] Ciolkowski I,Wanke D,Birkenbihl RP,Somssich IE Studies on DNA-binding selectivity of WRKY transcription factors lend structural clues into WRKY-domain function. Plant Mol. Biol., 2008. 68(1-2): p. 81-92 [PMID:18523729] Fu QT,Yu DQ [Expression profiles of AtWRKY25, AtWRKY26 and AtWRKY33 under abiotic stresses.]. Yi Chuan, 2010. 32(8): p. 848-56 [PMID:20709683] Li S,Fu Q,Chen L,Huang W,Yu D Arabidopsis thaliana WRKY25, WRKY26, and WRKY33 coordinate induction of plant thermotolerance. Planta, 2011. 233(6): p. 1237-52 [PMID:21336597] Cheng Y, et al. Structural and functional analysis of VQ motif-containing proteins in Arabidopsis as interacting proteins of WRKY transcription factors. Plant Physiol., 2012. 159(2): p. 810-25 [PMID:22535423] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178]