PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bHLH

Protein Properties

Length: 163aa MW: 18694.6 Da PI: 7.5729

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT4G25400.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	45.2	1.7e-14	5	54	4	55
HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS HLH 4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 h+e+E+rRR+++ s ++ Lr+llP + ++K s ++ ++ Av+YI +Lq AT4G25400.1 5 VHKEIEKRRRQEMASLYASLRSLLPLEF--IQGKRSTSDQVKGAVNYIDYLQ 54 6***********************65..*******************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	12.995	1	53	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	1.7E-12	3	65	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
CDD	cd00083	3.64E-9	3	58	No hit	No description
Gene3D	G3DSA:4.10.280.10	2.6E-11	4	67	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	1.4E-11	5	54	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SMART	SM00353	2.8E-6	7	59	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0090575	Cellular Component	RNA polymerase II transcription factor complex
GO:0000977	Molecular Function	RNA polymerase II regulatory region sequence-specific DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 163 aa Download sequence Send to blast
MEKLVHKEIE KRRRQEMASL YASLRSLLPL EFIQGKRSTS DQVKGAVNYI DYLQRNIKDI 60 NSKRDDLVLL SGRSFRSSNE QEWNEISNHV VIRPCLVGIE IVLSILQTPF SSVLQVLREH 120 GLYVLGYICS SVNDRLIHTL QAEVNDLALI DLADLKDTLT LMK

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.32261	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT4G25400
AtGenExpress	AT4G25400

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT4G25400.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT4G25400

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY142621	0.0	AY142621.1 Arabidopsis thaliana unknown protein (At4g25400) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_194270.2	1e-115	basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Swissprot	Q9STJ7	1e-117	BH118_ARATH; Transcription factor bHLH118
TrEMBL	A0A2H1ZEP9	1e-114	A0A2H1ZEP9_ARATH; Basic helix-loop-helix (BHLH) DNA-binding superfamily protein
TrEMBL	C0SVJ6	1e-114	C0SVJ6_ARATH; Uncharacterized protein At4g25400 (Fragment)
STRING	AT4G25400.1	1e-115	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4479	27	54
Representative plant	OGRP1638	8	38

Link Out ? help Back to Top
Phytozome	AT4G25400.1
Entrez Gene	828643
iHOP	AT4G25400
wikigenes	AT4G25400

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Heim MA, et al. The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity. Mol. Biol. Evol., 2003. 20(5): p. 735-47 [PMID:12679534] Toledo-Ortiz G,Huq E,Quail PH The Arabidopsis basic/helix-loop-helix transcription factor family. Plant Cell, 2003. 15(8): p. 1749-70 [PMID:12897250] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Bailey PC, et al. Update on the basic helix-loop-helix transcription factor gene family in Arabidopsis thaliana. Plant Cell, 2003. 15(11): p. 2497-502 [PMID:14600211]