![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G18890.1 | ||||||||
Common Name | BEH3, F13C5_60 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 284aa MW: 30907.6 Da PI: 8.4041 | ||||||||
Description | BES1/BZR1 homolog 3 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 210.2 | 5.5e-65 | 2 | 135 | 1 | 146 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR +Gn+klpk++DnneVlkALc+eAGw+vedDGttyrkg+kp+++++ ++ s+sasp+ss+q AT4G18890.1 2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAGWTVEDDGTTYRKGCKPMDRMDLMNGSTSASPCSSYQ--- 96 5899*******************************************************************************************... PP DUF822 99 kssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146 +sp++sy++sp+sssfpsp++ + +a+sl+p+l++ls+ AT4G18890.1 97 -----HSPRASYNPSPSSSSFPSPTN----PFGDANSLIPWLKNLSSN 135 .....*******************98....56677899****999763 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 2.4E-60 | 3 | 132 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 284 aa Download sequence Send to blast |
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRIHGNF KLPKHCDNNE VLKALCNEAG 60 WTVEDDGTTY RKGCKPMDRM DLMNGSTSAS PCSSYQHSPR ASYNPSPSSS SFPSPTNPFG 120 DANSLIPWLK NLSSNSPSKL PFFHGNSISA PVTPPLARSP TRDQVTIPDS GWLSGMQTPQ 180 SGPSSPTFSL VSRNPFFDKE AFKMGDCNSP MWTPGQSGNC SPAIPAGVDQ NSDVPMADGM 240 TAEFAFGCNA MAANGMVKPW EGERIHGECV SDDLELTLGN SRTR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 6e-24 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 6e-24 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 6e-24 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 6e-24 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.32859 | 0.0 | seed| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30684563 | 0.0 | ||||
Genevisible | 254610_at | 0.0 | ||||
Expression Atlas | AT4G18890 | - | ||||
AtGenExpress | AT4G18890 | - | ||||
ATTED-II | AT4G18890 | - |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00444 | DAP | 27203113 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G18890.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | brassinosteroid |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G18890 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK118850 | 0.0 | AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16. | |||
GenBank | AY088379 | 0.0 | AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence. | |||
GenBank | BT024512 | 0.0 | BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_193624.1 | 0.0 | BES1/BZR1 homolog 3 | ||||
Swissprot | O49404 | 0.0 | BEH3_ARATH; BES1/BZR1 homolog protein 3 | ||||
TrEMBL | A0A384KGL8 | 0.0 | A0A384KGL8_ARATH; BEH3 | ||||
TrEMBL | Q2HIR9 | 0.0 | Q2HIR9_ARATH; At4g18890 | ||||
STRING | AT4G18890.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1917 | 27 | 81 |
Representative plant | OGRP1595 | 15 | 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G18890.1 |
Entrez Gene | 827623 |
iHOP | AT4G18890 |
wikigenes | AT4G18890 |
Publications ? help Back to Top | |||
---|---|---|---|
|