| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 60 | 3.7e-19 | 134 | 188 | 2 | 56 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
rk+ +++k+q +Le+ F+++++++ +++ LAkklgLt rqV vWFqNrRa+ k
AT4G17460.1 134 RKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTK 188
677889***********************************************98 PP
|
| 2 | HD-ZIP_I/II | 122.8 | 1.6e-39 | 134 | 223 | 1 | 91 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91
+kk+rlsk+q+++LE++F+e+++L+p++K +la++Lgl++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rLeke +eLr +l
AT4G17460.1 134 RKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRLEKEAAELR-AL 223
69*************************************************************************************9.54 PP
|
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
Science, 2000. 290(5499): p. 2105-10
[PMID:11118137] - Bancroft I
Duplicate and diverge: the evolution of plant genome microstructure.
Trends Genet., 2001. 17(2): p. 89-93
[PMID:11173118] - Dal Bosco C, et al.
Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
J. Biol. Chem., 2004. 279(2): p. 1060-9
[PMID:14576160] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science, 2003. 302(5646): p. 842-6
[PMID:14593172] - Pufky J,Qiu Y,Rao MV,Hurban P,Jones AM
The auxin-induced transcriptome for etiolated Arabidopsis seedlings using a structure/function approach.
Funct. Integr. Genomics, 2003. 3(4): p. 135-43
[PMID:14648238] - Hu W,Wang Y,Bowers C,Ma H
Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
Plant Mol. Biol., 2003. 53(4): p. 545-63
[PMID:15010618] - Rana D, et al.
Conservation of the microstructure of genome segments in Brassica napus and its diploid relatives.
Plant J., 2004. 40(5): p. 725-33
[PMID:15546355] - Henriksson E, et al.
Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
Plant Physiol., 2005. 139(1): p. 509-18
[PMID:16055682] - Deng X, et al.
A homeodomain leucine zipper gene from Craterostigma plantagineum regulates abscisic acid responsive gene expression and physiological responses.
Plant Mol. Biol., 2006. 61(3): p. 469-89
[PMID:16830180] - Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
Light has a specific role in modulating Arabidopsis gene expression at low temperature.
BMC Plant Biol., 2008. 8: p. 13
[PMID:18230142] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
Plant Physiol., 2008. 148(1): p. 436-54
[PMID:18650403] - Ciarbelli AR, et al.
The Arabidopsis homeodomain-leucine zipper II gene family: diversity and redundancy.
Plant Mol. Biol., 2008. 68(4-5): p. 465-78
[PMID:18758690] - Krishnaswamy SS, et al.
Transcriptional profiling of pea ABR17 mediated changes in gene expression in Arabidopsis thaliana.
BMC Plant Biol., 2008. 8: p. 91
[PMID:18783601] - Sorin C,Salla-Martret M,Bou-Torrent J,Roig-Villanova I,Martínez-García JF
ATHB4, a regulator of shade avoidance, modulates hormone response in Arabidopsis seedlings.
Plant J., 2009. 59(2): p. 266-77
[PMID:19392702] - Hanada K, et al.
Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
Mol. Biol. Evol., 2011. 28(1): p. 377-82
[PMID:20736450] - Causier B,Ashworth M,Guo W,Davies B
The TOPLESS interactome: a framework for gene repression in Arabidopsis.
Plant Physiol., 2012. 158(1): p. 423-38
[PMID:22065421] - Z
JAIBA, a class-II HD-ZIP transcription factor involved in the regulation of meristematic activity, and important for correct gynoecium and fruit development in Arabidopsis.
Plant J., 2012. 71(2): p. 314-26
[PMID:22409594] - Z
The class II HD-ZIP JAIBA gene is involved in meristematic activity and important for gynoecium and fruit development in Arabidopsis.
Plant Signal Behav, 2012. 7(11): p. 1501-3
[PMID:22951401] - Zhang D, et al.
Transcription factor HAT1 is phosphorylated by BIN2 kinase and mediates brassinosteroid repressed gene expression in Arabidopsis.
Plant J., 2014. 77(1): p. 59-70
[PMID:24164091] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Zhang D, et al.
Transcription factors involved in brassinosteroid repressed gene expression and their regulation by BIN2 kinase.
Plant Signal Behav, 2014. 9(1): p. e27849
[PMID:24526246] - Mar
Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
Plant Physiol., 2014. 166(2): p. 1022-32
[PMID:25118255] - Zou LJ, et al.
Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
Plant Cell Physiol., 2016. 57(9): p. 1879-89
[PMID:27328697] - Lozano-Sotomayor P, et al.
Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
Plant J., 2016. 88(3): p. 437-451
[PMID:27402171] - Tan W, et al.
Transcription factor HAT1 is a substrate of SnRK2.3 kinase and negatively regulates ABA synthesis and signaling in Arabidopsis responding to drought.
PLoS Genet., 2018. 14(4): p. e1007336
[PMID:29659577] - Schena M,Davis RW
Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families.
Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7
[PMID:7915839]
|
