 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
AT3G61850.3 |
| Common Name | BBFA, DAG1, DOF3.7, F21F14.20 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
| Family |
Dof |
| Protein Properties |
Length: 284aa MW: 31542.9 Da PI: 9.8563 |
| Description |
Dof family protein |
| Gene Model |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | zf-Dof | 123.4 | 7.6e-39 | 58 | 118 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+ss
AT3G61850.3 58 PQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSS 118
6899******************************************************986 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0009639 | Biological Process | response to red or far red light |
| GO:0009845 | Biological Process | seed germination |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
| GO:0046872 | Molecular Function | metal ion binding |
| Sequence ? help Back to Top |
| Protein Sequence Length: 284 aa
Download sequence Send
to blast |
MINVKPMEQM ISSTNNNTPQ QQPTFIATNT RPNATASNGG SGGNTNNTAT METRKARPQE 60
KVNCPRCNST NTKFCYYNNY SLTQPRYFCK GCRRYWTEGG SLRNVPVGGS SRKNKRSSTP 120
LASPSNPKLP DLNPPILFSS QIPNKSNKDL NLLSFPVMQD HHHHALELLR SNGVSSRGMN 180
TFLPGQMMDS NSVLYSSLGF PTMPDYKQSN NNLSFSIDHH QGIGHNTINS NQRAQDNNDD 240
MNGASRVLFP FSDMKELSST TQEKSHGNNT YWNGMFSNTG GSSW
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos. |
| Uniprot | TISSUE SPECIFICITY: Expressed in the phloem of the mother plant, including in roots, stem, leaves and flowers, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| TAIR | Zinc finger transcription factor of the Dof family involved in the control of seed germination. |
| UniProt | Transcription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception. |
| Function -- GeneRIF ? help
Back to Top |
- Data show that AtGA3ox1 is directly regulated by DAG1, and suggest that DAG1 is not a direct regulatory target of PIL5.
[PMID: 19874540] - ELIP (EARLY LIGHT-INDUCED PROTEIN) genes of Arabidopsis are involved in seed germination and that they act downstream of the Dof protein DAG1, although they are not its direct regulatory targets.
[PMID: 21299564] - DAG1 and the DELLA protein GAI cooperate in negatively regulating the AtGA3ox1 gene
[PMID: 24719470] - GAI interacts with DAG1 in embryo development.
[PMID: 25064446] - DAG2 is a positive regulator of the light-mediated seed germination process, and particularly reveal that this protein plays its main role downstream of PIL5 and DAG1 in the phytochrome B (phyB)-mediated pathway.
[PMID: 25850831]
|
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AK117352 | 0.0 | AK117352.1 Arabidopsis thaliana At3g61850 mRNA for putative transcription factor BBFa, complete cds, clone: RAFL16-91-P20. |
| GenBank | BT033127 | 0.0 | BT033127.1 Arabidopsis thaliana unknown protein (At3g61850) mRNA, complete cds. |
| GenBank | X97941 | 0.0 | X97941.2 A.thaliana mRNA for zinc finger protein DAG1 (BBFa). |
| Publications
? help Back to Top |
- Papi M, et al.
Identification and disruption of an Arabidopsis zinc finger gene controlling seed germination.
Genes Dev., 2000. 14(1): p. 28-33
[PMID:10640273] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
Science, 2000. 290(5499): p. 2105-10
[PMID:11118137] - Papi M, et al.
Inactivation of the phloem-specific Dof zinc finger gene DAG1 affects response to light and integrity of the testa of Arabidopsis seeds.
Plant Physiol., 2002. 128(2): p. 411-7
[PMID:11842145] - Seki M, et al.
Functional annotation of a full-length Arabidopsis cDNA collection.
Science, 2002. 296(5565): p. 141-5
[PMID:11910074] - Gualberti G, et al.
Mutations in the Dof zinc finger genes DAG2 and DAG1 influence with opposite effects the germination of Arabidopsis seeds.
Plant Cell, 2002. 14(6): p. 1253-63
[PMID:12084825] - Che P,Gingerich DJ,Lall S,Howell SH
Global and hormone-induced gene expression changes during shoot development in Arabidopsis.
Plant Cell, 2002. 14(11): p. 2771-85
[PMID:12417700] - Yanagisawa S
The Dof family of plant transcription factors.
Trends Plant Sci., 2002. 7(12): p. 555-60
[PMID:12475498] - Lee JY, et al.
Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
[PMID:16581911] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
Plant Physiol., 2008. 148(1): p. 436-54
[PMID:18650403] - Gabriele S, et al.
The Dof protein DAG1 mediates PIL5 activity on seed germination by negatively regulating GA biosynthetic gene AtGA3ox1.
Plant J., 2010. 61(2): p. 312-23
[PMID:19874540] - Brady SM, et al.
A stele-enriched gene regulatory network in the Arabidopsis root.
Mol. Syst. Biol., 2011. 7: p. 459
[PMID:21245844] - Rizza A,Boccaccini A,Lopez-Vidriero I,Costantino P,Vittorioso P
Inactivation of the ELIP1 and ELIP2 genes affects Arabidopsis seed germination.
New Phytol., 2011. 190(4): p. 896-905
[PMID:21299564] - Gaudinier A, et al.
Enhanced Y1H assays for Arabidopsis.
Nat. Methods, 2011. 8(12): p. 1053-5
[PMID:22037706] - Boccaccini A, et al.
The DOF protein DAG1 and the DELLA protein GAI cooperate in negatively regulating the AtGA3ox1 gene.
Mol Plant, 2014. 7(9): p. 1486-9
[PMID:24719470] - Boccaccini A, et al.
Independent and interactive effects of DOF affecting germination 1 (DAG1) and the Della proteins GA insensitive (GAI) and Repressor of ga1-3 (RGA) in embryo development and seed germination.
BMC Plant Biol., 2014. 14: p. 200
[PMID:25064446] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
Mol. Biol. Evol., 2015. 32(7): p. 1767-73
[PMID:25750178] - Santopolo S, et al.
DOF AFFECTING GERMINATION 2 is a positive regulator of light-mediated seed germination and is repressed by DOF AFFECTING GERMINATION 1.
BMC Plant Biol., 2015. 15: p. 72
[PMID:25850831] - De Paolis A,Sabatini S,De Pascalis L,Costantino P,Capone I
A rolB regulatory factor belongs to a new class of single zinc finger plant proteins.
Plant J., 1996. 10(2): p. 215-23
[PMID:8771779]
|
