 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
AT3G06490.1 |
| Common Name | AtMYB108, BOS1, F5E6.18, MYB108 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
| Family |
MYB |
| Protein Properties |
Length: 323aa MW: 37019.7 Da PI: 4.6626 |
| Description |
myb domain protein 108 |
| Gene Model |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 53.2 | 7.1e-17 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+WT+eEd +l ++++ G g+W++ +r+ g+ Rt+k+c++rw++yl
AT3G06490.1 21 RGPWTAEEDFKLMNYIATNGEGRWNSLSRCAGLQRTGKSCRLRWLNYL 68
89********************************************97 PP
|
| 2 | Myb_DNA-binding | 50.5 | 4.8e-16 | 74 | 117 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
AT3G06490.1 74 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117
7999******************.*********.***********96 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter |
| GO:0006952 | Biological Process | defense response |
| GO:0009620 | Biological Process | response to fungus |
| GO:0009651 | Biological Process | response to salt stress |
| GO:0009723 | Biological Process | response to ethylene |
| GO:0009737 | Biological Process | response to abscisic acid |
| GO:0009753 | Biological Process | response to jasmonic acid |
| GO:0030154 | Biological Process | cell differentiation |
| GO:0005634 | Cellular Component | nucleus |
| GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding |
| GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
| Sequence ? help Back to Top |
| Protein Sequence Length: 323 aa
Download sequence Send
to blast |
MDEKGRSLKN NNMEDEMDLK RGPWTAEEDF KLMNYIATNG EGRWNSLSRC AGLQRTGKSC 60
RLRWLNYLRP DVRRGNITLE EQLLILELHS RWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ 120
KHAKQLKCDV NSQQFKDTMK YLWMPRLVER IQSASASSAA AATTTTTTTT GSAGTSSCIT 180
TSNNQFMNYD YNNNNMGQQF GVMSNNDYIT PENSSVAVSP ASDLTEYYSA PNPNPEYYSG 240
QMGNSYYPDQ NLVSSQLLPD NYFDYSGLLD EDLTAMQEQS NLSWFENING AASSSDSLWN 300
IGETDEEFWF LQQQQQFNNN GSF
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Expressed specifically in flowers. Restricted to anthers in maturing flowers. Strongest expression in the vascular and connective tissue where the anther attaches to the filament. Not detected in pollen. {ECO:0000269|PubMed:19091873}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| TAIR | putative transcription factor MYB108 (MYB108) mRNA, |
| UniProt | Transcription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:20921156, ECO:0000269|PubMed:23952703}. |
| Function -- GeneRIF ? help
Back to Top |
- Complexes containing R2R3 MYB and bHLH transcription factors regulate the expression of TTG2, which then regulates GL2 expression with complexes containing R2R3 MYB.
[PMID: 17766401] - MYB108 and MYB24 have overlapping functions and act downstream of MYB21 in a transcriptional cascade that mediates stamen and pollen maturation in response to jasmonate in Arabidopsis.
[PMID: 19091873] - a new role in cell cycle regulation
[PMID: 19881525] - after D. dadantii infection, the expression of the Arabidopsis BOS1 gene was specifically induced by the production of the bacterial PelB/C pectinases able to degrade pectin
[PMID: 21533045] - The direct involvement of dark-induced Tic55 protein in chlorophyll catabolism and its indirect role in the MYB108-NAC signaling pathway during leaf senescence has been described.
[PMID: 29937503]
|
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873}. |
| Regulation -- Hormone ? help
Back to Top |
| Source |
Hormone |
| AHD | abscisic acid, ethylene, jasmonic acid, Jasmonic acid |
| Phenotype -- Disruption Phenotype ? help
Back to Top |
| Source |
Description |
| UniProt | DISRUPTION PHENOTYPE: Reduced male fertility associated with delayed anther dehiscence, reduced pollen viability and decreased fecundity. Increased susceptibility to Botrytis infection. Myb24 and myb108 double mutant has a reduced fertility and a greatly reduced seed set relative to the myb108 parental allele. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AF262733 | 0.0 | AF262733.2 Arabidopsis thaliana putative transcription factor MYB108 (MYB108) mRNA, complete cds. |
| Orthologous Group
? help Back to Top |
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Representative plant | OGRP5 | 17 | 1784 |
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
Science, 2000. 290(5499): p. 2105-10
[PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana.
Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
[PMID:11597504] - Mengiste T,Chen X,Salmeron J,Dietrich R
The BOTRYTIS SUSCEPTIBLE1 gene encodes an R2R3MYB transcription factor protein that is required for biotic and abiotic stress responses in Arabidopsis.
Plant Cell, 2003. 15(11): p. 2551-65
[PMID:14555693] - Veronese P, et al.
The BOS loci of Arabidopsis are required for resistance to Botrytis cinerea infection.
Plant J., 2004. 40(4): p. 558-74
[PMID:15500471] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
Mol. Biol. Evol., 2006. 23(2): p. 469-78
[PMID:16280546] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
Plant Mol. Biol., 2006. 60(1): p. 107-24
[PMID:16463103] - Truman W,de Zabala MT,Grant M
Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
Plant J., 2006. 46(1): p. 14-33
[PMID:16553893] - Thilmony R,Underwood W,He SY
Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7.
Plant J., 2006. 46(1): p. 34-53
[PMID:16553894] - Mandaokar A, et al.
Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
Plant J., 2006. 46(6): p. 984-1008
[PMID:16805732] - Ishida T, et al.
Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation.
Plant Cell, 2007. 19(8): p. 2531-43
[PMID:17766401] - Mandaokar A,Browse J
MYB108 acts together with MYB24 to regulate jasmonate-mediated stamen maturation in Arabidopsis.
Plant Physiol., 2009. 149(2): p. 851-62
[PMID:19091873] - Cominelli E,Tonelli C
A new role for plant R2R3-MYB transcription factors in cell cycle regulation.
Cell Res., 2009. 19(11): p. 1231-2
[PMID:19881525] - Luo H, et al.
The Arabidopsis Botrytis Susceptible1 Interactor defines a subclass of RING E3 ligases that regulate pathogen and stress responses.
Plant Physiol., 2010. 154(4): p. 1766-82
[PMID:20921156] - Kraepiel Y, et al.
Analysis of the plant bos1 mutant highlights necrosis as an efficient defence mechanism during D. dadantii/Arabidospis thaliana interaction.
PLoS ONE, 2011. 6(4): p. e18991
[PMID:21533045] - Cui F,Brosch
Regulation of ABA dependent wound induced spreading cell death by MYB108.
New Phytol., 2013. 200(3): p. 634-40
[PMID:23952703] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
Mol. Biol. Evol., 2015. 32(7): p. 1767-73
[PMID:25750178] - Cheng HQ, et al.
The cotton MYB108 forms a positive feedback regulation loop with CML11 and participates in the defense response against Verticillium dahliae infection.
J. Exp. Bot., 2016. 67(6): p. 1935-50
[PMID:26873979] - Sanz-Fernández M, et al.
Screening Arabidopsis mutants in genes useful for phytoremediation.
J. Hazard. Mater., 2017. 335: p. 143-151
[PMID:28441590] - Chou ML, et al.
The Direct Involvement of Dark-Induced Tic55 Protein in Chlorophyll Catabolism and Its Indirect Role in the MYB108-NAC Signaling Pathway during Leaf Senescence in Arabidopsis thaliana.
Int J Mol Sci, 2018.
[PMID:29937503]
|
