 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
AT2G47810.1 |
| Common Name | F17A22.20, NFYB5, NF-YB5 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
| Family |
NF-YB |
| Protein Properties |
Length: 160aa MW: 18122.3 Da PI: 6.9529 |
| Description |
nuclear factor Y, subunit B5 |
| Gene Model |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NF-YB | 173.9 | 1.6e-54 | 49 | 145 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
v+eqdr+lPianv+rimk++lPanak+sk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy+++lk+yl++yr legek
AT2G47810.1 49 VKEQDRLLPIANVGRIMKNILPANAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAAQLKKYLHRYRVLEGEK 145
58********************************************************************************************997 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| GO:0046982 | Molecular Function | protein heterodimerization activity |
| Sequence ? help Back to Top |
| Protein Sequence Length: 160 aa
Download sequence Send
to blast |
MAGNYHSFQN PIPRYQNYNF GSSSSNHQHE HDGLVVVVED QQQEESMMVK EQDRLLPIAN 60
VGRIMKNILP ANAKVSKEAK ETMQECVSEF ISFVTGEASD KCHKEKRKTV NGDDICWAMA 120
NLGFDDYAAQ LKKYLHRYRV LEGEKPNHHG KGGPKSSPDN
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 4g91_B | 1e-43 | 49 | 139 | 1 | 91 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-43 | 49 | 139 | 1 | 91 | Transcription factor HapC (Eurofung) |
| 5g49_A | 2e-43 | 47 | 139 | 4 | 96 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase |
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
| Interaction ? help
Back to Top |
| Source |
Intact With |
| BioGRID | AT3G48590, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G08970, AT1G09030, AT1G54830, AT1G56170 |
| IntAct | Search O82248 |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AC005309 | 0.0 | AC005309.3 Arabidopsis thaliana chromosome 2 clone F17A22 map CIC06C03, complete sequence. |
| GenBank | BT003968 | 0.0 | BT003968.1 Arabidopsis thaliana clone RAFL15-27-K05 (R20859) putative CCAAT-box binding trancription factor (At2g47810) mRNA, complete cds. |
| GenBank | BT005081 | 0.0 | BT005081.1 Arabidopsis thaliana clone U20859 putative CCAAT-box binding trancription factor (At2g47810) mRNA, complete cds. |
| GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
Science, 2000. 290(5499): p. 2105-10
[PMID:11118137] - Gusmaroli G,Tonelli C,Mantovani R
Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
Gene, 2001. 264(2): p. 173-85
[PMID:11250072] - Gusmaroli G,Tonelli C,Mantovani R
Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
Gene, 2002. 283(1-2): p. 41-8
[PMID:11867211] - Kwong RW, et al.
LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development.
Plant Cell, 2003. 15(1): p. 5-18
[PMID:12509518] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science, 2003. 302(5646): p. 842-6
[PMID:14593172] - Wenkel S, et al.
CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis.
Plant Cell, 2006. 18(11): p. 2971-84
[PMID:17138697] - Hackenberg D, et al.
Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
Mol Plant, 2012. 5(4): p. 876-88
[PMID:22199235] - Calvenzani V, et al.
Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits.
PLoS ONE, 2012. 7(8): p. e42902
[PMID:22912760] - Zhao H, et al.
The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
Front Plant Sci, 2016. 7: p. 2045
[PMID:28119722]
|
