PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WRKY

Protein Properties

Length: 109aa MW: 12951.8 Da PI: 9.9919

Description

WRKY DNA-binding protein 43

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G46130.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	103.8	9.7e-33	29	87	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt++ C+vkk+v+r ++++++ve+tYeg Hnh+ AT2G46130.1 29 LDDGYRWRKYGQKSVKNSLYPRSYYRCTQHMCNVKKQVQRLSKETSIVETTYEGIHNHP 87 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.0E-33	14	87	IPR003657	WRKY domain
SuperFamily	SSF118290	1.44E-28	21	88	IPR003657	WRKY domain
PROSITE profile	PS50811	27.714	24	89	IPR003657	WRKY domain
SMART	SM00774	3.4E-37	29	88	IPR003657	WRKY domain
Pfam	PF03106	3.3E-26	30	87	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009046	anatomy	flower
PO:0020100	anatomy	hypocotyl
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
MNGLVDSSRD KKMKNPRFSF RTKSDADILD DGYRWRKYGQ KSVKNSLYPR SYYRCTQHMC 60 NVKKQVQRLS KETSIVETTY EGIHNHPCEE LMQTLTPLLH QLQFLSKFT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	7e-25	19	86	7	74	Probable WRKY transcription factor 4
2lex_A	7e-25	19	86	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	266597_at	1e-161
Expression Atlas	AT2G46130	-
AtGenExpress	AT2G46130	-
ATTED-II	AT2G46130	-

Functional Description ? help Back to Top
Source	Description
TAIR	member of WRKY Transcription Factor; Group II-c
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00317	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G46130.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q8GY11

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G46130

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117931	0.0	AK117931.1 Arabidopsis thaliana At2g46130 mRNA for putative WRKY transcription factor (WRKY43), complete cds, clone: RAFL19-12-A14.
GenBank	BT004701	0.0	BT004701.1 Arabidopsis thaliana At2g46130 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_182136.2	2e-78	WRKY DNA-binding protein 43
Swissprot	Q8GY11	2e-79	WRK43_ARATH; Probable WRKY transcription factor 43
TrEMBL	D7LDW5	5e-69	D7LDW5_ARALL; WRKY DNA-binding protein 43
STRING	AT2G46130.1	9e-78	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM509	28	154
Representative plant	OGRP14	17	875

Link Out ? help Back to Top
Phytozome	AT2G46130.1
Entrez Gene	819220
iHOP	AT2G46130
wikigenes	AT2G46130

Publications ? help Back to Top
Eulgem T,Rushton PJ,Robatzek S,Somssich IE The WRKY superfamily of plant transcription factors. Trends Plant Sci., 2000. 5(5): p. 199-206 [PMID:10785665] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Scheible WR, et al. Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen. Plant Physiol., 2004. 136(1): p. 2483-99 [PMID:15375205] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Ciolkowski I,Wanke D,Birkenbihl RP,Somssich IE Studies on DNA-binding selectivity of WRKY transcription factors lend structural clues into WRKY-domain function. Plant Mol. Biol., 2008. 68(1-2): p. 81-92 [PMID:18523729] Geilen K,Heilmann M,Hillmer S,Böhmer M WRKY43 regulates polyunsaturated fatty acid content and seed germination under unfavourable growth conditions. Sci Rep, 2017. 7(1): p. 14235 [PMID:29079824]