![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G38880.2 | ||||||||
Common Name | ATHAP3, ATNF-YB1, HAP3, HAP3A, NFYB1, NF-YB1, T7F6.5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 141aa MW: 15180.9 Da PI: 4.5966 | ||||||||
Description | nuclear factor Y, subunit B1 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.4 | 3.6e-57 | 19 | 116 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 vreqdr+lPian+srimkk+lP n+ki+kdak+tvqecvsefisf+tseasdkcq+ekrkt+ngddllwa+atlGfedy+eplk+yl++yreleg++k AT2G38880.2 19 VREQDRYLPIANISRIMKKALPPNGKIGKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGDDLLWAMATLGFEDYLEPLKIYLARYRELEGDNK 116 69*********************************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.7E-54 | 17 | 129 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.02E-41 | 22 | 133 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.4E-27 | 25 | 89 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.7E-21 | 53 | 71 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 56 | 72 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.7E-21 | 72 | 90 | No hit | No description |
PRINTS | PR00615 | 4.7E-21 | 91 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000005 | anatomy | cultured plant cell | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MADTPSSPAG DGGESGGSVR EQDRYLPIAN ISRIMKKALP PNGKIGKDAK DTVQECVSEF 60 ISFITSEASD KCQKEKRKTV NGDDLLWAMA TLGFEDYLEP LKIYLARYRE LEGDNKGSGK 120 SGDGSNRDAG GGVSGEEMPS W |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-48 | 18 | 110 | 1 | 93 | NF-YB |
4awl_B | 2e-48 | 18 | 110 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-48 | 18 | 110 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.24820 | 0.0 | floral meristem| flower |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 266171_at | 0.0 | ||||
Expression Atlas | AT2G38880 | - | ||||
AtGenExpress | AT2G38880 | - | ||||
ATTED-II | AT2G38880 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in leaves, flowers and siliques. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a transcription factor from the nuclear factor Y (NF-Y) family, AtNF-YB1. Confers drought tolerance. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00300 | DAP | 27203113 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G38880.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT3G48590, AT3G54390, AT5G15840, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G08970, AT1G28050, AT1G54060, AT1G54830, AT1G56170 | |||||
IntAct | Search Q9SLG0 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G38880 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT004266 | 0.0 | BT004266.1 Arabidopsis thaliana clone RAFL15-29-F19 (R20926) putative CCAAT-binding transcription factor subunit (At2g38880) mRNA, complete cds. | |||
GenBank | BT005536 | 0.0 | BT005536.1 Arabidopsis thaliana clone U20926 putative CCAAT-binding transcription factor subunit (At2g38880) mRNA, complete cds. | |||
GenBank | DQ333305 | 0.0 | DQ333305.1 Arabidopsis thaliana transcription factor subunit NF-YB1 mRNA, complete cds. | |||
GenBank | Y13723 | 0.0 | Y13723.1 Arabidopsis thaliana mRNA for Hap3a transcription factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001031511.1 | 1e-100 | nuclear factor Y, subunit B1 | ||||
Refseq | NP_030436.1 | 1e-100 | nuclear factor Y, subunit B1 | ||||
Refseq | NP_850304.2 | 1e-100 | nuclear factor Y, subunit B1 | ||||
Refseq | XP_002879771.1 | 1e-100 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | Q9SLG0 | 1e-101 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | A6XB86 | 2e-98 | A6XB86_ARATH; Transcription factor subunit NF-YB1 | ||||
TrEMBL | D7LCC9 | 2e-98 | D7LCC9_ARALL; Uncharacterized protein | ||||
STRING | scaffold_402629.1 | 3e-99 | (Arabidopsis lyrata) | ||||
STRING | Bostr.23794s0182.1.p | 3e-99 | (Boechera stricta) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G38880.2 |
Entrez Gene | 818472 |
iHOP | AT2G38880 |
wikigenes | AT2G38880 |