PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 298aa MW: 33250.7 Da PI: 5.2396

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G38090.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	29.4	1.8e-09	28	73	3	46
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46 +WT+eE +++ +a + + ++ +W+++a++++ g+t +++ ++ AT2G38090.1 28 KWTAEENKKFENALAFYDKDtpdRWSRVAAMLP-GKTVGDVIKQYRE 73 8******************************.****9999986 PP
2	Myb_DNA-binding	48.6	1.9e-15	142	186	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky AT2G38090.1 142 PWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 186 8*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.2E-5	23	74	IPR009057	Homeodomain-like
PROSITE profile	PS51293	8.986	24	79	IPR017884	SANT domain
SMART	SM00717	1.5E-10	25	77	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.17E-11	27	81	IPR009057	Homeodomain-like
CDD	cd00167	3.96E-8	28	74	No hit	No description
Pfam	PF00249	9.8E-8	28	73	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	21.845	135	191	IPR017930	Myb domain
SuperFamily	SSF46689	1.66E-17	137	190	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	7.5E-18	138	190	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	2.7E-13	139	186	IPR009057	Homeodomain-like
SMART	SM00717	8.7E-14	139	189	IPR001005	SANT/Myb domain
Pfam	PF00249	7.8E-13	142	186	IPR001005	SANT/Myb domain
CDD	cd00167	1.76E-11	142	187	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 298 aa Download sequence Send to blast
MNRGIEVMSP ATYLETSNWL FQENRGTKWT AEENKKFENA LAFYDKDTPD RWSRVAAMLP 60 GKTVGDVIKQ YRELEEDVSD IEAGLIPIPG YASDSFTLDW GGYDGASGNN GFNMNGYYFS 120 AAGGKRGSAA RTAEHERKKG VPWTEEEHRQ FLMGLKKYGK GDWRNIARNF VTTRTPTQVA 180 SHAQKYFIRQ VNGGKDKRRS SIHDITTVNI PDSPDAAAAD NATANAPCSP PSVGGNQRET 240 SEWEGQTLYD ETAAAFYNQN AFSETLLGMS STPYMAKLQE QSFLNASQFE SYNAYLQM

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2cjj_A	4e-17	26	93	8	75	RADIALIS
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.46819	0.0	flower\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	42569721	0.0
Genevisible	267141_at	0.0
Expression Atlas	AT2G38090	-
AtGenExpress	AT2G38090	-
ATTED-II	AT2G38090	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269\|PubMed:11937495}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269\|PubMed:11937495, ECO:0000269\|PubMed:9118809}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00296	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G38090.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G38090

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK118135	0.0	AK118135.1 Arabidopsis thaliana At2g38090 mRNA for putative MYB family transcription factor, complete cds, clone: RAFL19-43-J04.
GenBank	AY519529	0.0	AY519529.1 Arabidopsis thaliana MYB transcription factor (At2g38090) mRNA, complete cds.
GenBank	BT006122	0.0	BT006122.1 Arabidopsis thaliana clone U50930 putative MYB family transcription factor (At2g38090) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_181344.2	0.0	Duplicated homeodomain-like superfamily protein
Swissprot	Q8S9H7	6e-96	DIV_ANTMA; Transcription factor DIVARICATA
TrEMBL	A0A178VZA4	0.0	A0A178VZA4_ARATH; Uncharacterized protein
TrEMBL	Q8GXN7	0.0	Q8GXN7_ARATH; Duplicated homeodomain-like superfamily protein
STRING	AT2G38090.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1228	27	100
Representative plant	OGRP275	17	122

Link Out ? help Back to Top
Phytozome	AT2G38090.1
Entrez Gene	818387
iHOP	AT2G38090
wikigenes	AT2G38090

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Galego L,Almeida J Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers. Genes Dev., 2002. 16(7): p. 880-91 [PMID:11937495] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Cao D,Cheng H,Wu W,Soo HM,Peng J Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] Baxter CJ, et al. The metabolic response of heterotrophic Arabidopsis cells to oxidative stress. Plant Physiol., 2007. 143(1): p. 312-25 [PMID:17122072] Panjabi P, et al. Comparative mapping of Brassica juncea and Arabidopsis thaliana using Intron Polymorphism (IP) markers: homoeologous relationships, diversification and evolution of the A, B and C Brassica genomes. BMC Genomics, 2008. 9: p. 113 [PMID:18315867] Machemer K, et al. Interplay of MYB factors in differential cell expansion, and consequences for tomato fruit development. Plant J., 2011. 68(2): p. 337-50 [PMID:21707804] Almeida J,Rocheta M,Galego L Genetic control of flower shape in Antirrhinum majus. Development, 1997. 124(7): p. 1387-92 [PMID:9118809]