 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
AT2G37060.1 |
| Common Name | NFYB8, NF-YB8, T2N18.18 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
| Family |
NF-YB |
| Protein Properties |
Length: 173aa MW: 18998.3 Da PI: 6.9337 |
| Description |
nuclear factor Y, subunit B8 |
| Gene Model |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NF-YB | 184.5 | 8.3e-58 | 28 | 125 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98
vreqdrflPian+srimk+ lPan+ki+kdake+vqecvsefisfvtseasdkcqrekrktingddllwa+atlGfedy+eplkvyl++yre+eg++k
AT2G37060.1 28 VREQDRFLPIANISRIMKRGLPANGKIAKDAKEIVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYMEPLKVYLMRYREMEGDTK 125
69*********************************************************************************************975 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| GO:0046982 | Molecular Function | protein heterodimerization activity |
| Sequence ? help Back to Top |
| Protein Sequence Length: 173 aa
Download sequence Send
to blast |
MAESQAKSPG GCGSHESGGD QSPRSLHVRE QDRFLPIANI SRIMKRGLPA NGKIAKDAKE 60
IVQECVSEFI SFVTSEASDK CQREKRKTIN GDDLLWAMAT LGFEDYMEPL KVYLMRYREM 120
EGDTKGSAKG GDPNAKKDGQ SSQNGQFSQL AHQGPYGNSQ AQQHMMVPMP GTD
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 4awl_B | 1e-46 | 26 | 119 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-46 | 26 | 119 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4g91_B | 1e-46 | 28 | 119 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-46 | 28 | 119 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase |
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AY070477 | 0.0 | AY070477.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds. |
| GenBank | AY091673 | 0.0 | AY091673.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds. |
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
Science, 2000. 290(5499): p. 2105-10
[PMID:11118137] - Gusmaroli G,Tonelli C,Mantovani R
Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
Gene, 2001. 264(2): p. 173-85
[PMID:11250072] - Gusmaroli G,Tonelli C,Mantovani R
Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
Gene, 2002. 283(1-2): p. 41-8
[PMID:11867211] - Kwong RW, et al.
LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development.
Plant Cell, 2003. 15(1): p. 5-18
[PMID:12509518] - Dal Bosco C, et al.
Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
J. Biol. Chem., 2004. 279(2): p. 1060-9
[PMID:14576160] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science, 2003. 302(5646): p. 842-6
[PMID:14593172] - Hoth S, et al.
Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
FEBS Lett., 2003. 554(3): p. 373-80
[PMID:14623097] - Gutierrez L, et al.
Identification of new gene expression regulators specifically expressed during plant seed maturation.
J. Exp. Bot., 2006. 57(9): p. 1919-32
[PMID:16606634] - Wang Y, et al.
Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
Plant Physiol., 2008. 148(3): p. 1201-11
[PMID:18775970] - Hackenberg D, et al.
Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
Mol Plant, 2012. 5(4): p. 876-88
[PMID:22199235] - Calvenzani V, et al.
Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits.
PLoS ONE, 2012. 7(8): p. e42902
[PMID:22912760] - Efroni I, et al.
Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
Dev. Cell, 2013. 24(4): p. 438-45
[PMID:23449474] - Zhao H, et al.
The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
Front Plant Sci, 2016. 7: p. 2045
[PMID:28119722]
|
