![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G30250.1 | ||||||||
Common Name | ATWRKY25, T9D9.6, WRKY25 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 393aa MW: 44133.6 Da PI: 6.4324 | ||||||||
Description | WRKY DNA-binding protein 25 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 94.7 | 6.7e-30 | 166 | 223 | 2 | 60 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 +Dgy WrKYGqK+vk+se+prsY++Ct+++C +kk ve+++ d++++ei+Y+g Hnh+k AT2G30250.1 166 NDGYGWRKYGQKQVKKSENPRSYFKCTYPDCVSKKIVETAS-DGQITEIIYKGGHNHPK 223 8***************************************9.***************85 PP | |||||||
2 | WRKY | 103.4 | 1.2e-32 | 329 | 385 | 3 | 59 |
-SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 Dg++WrKYGqK+vkg+++prsYY+Ct++gC vkk+versa d+++v +tYeg+Hnh+ AT2G30250.1 329 DGFRWRKYGQKVVKGNTNPRSYYKCTFQGCGVKKQVERSAADERAVLTTYEGRHNHD 385 9*******************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.2E-24 | 158 | 224 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 7.45E-23 | 163 | 224 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.9E-30 | 165 | 223 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.2E-22 | 166 | 222 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 20.346 | 166 | 224 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 1.0E-33 | 312 | 387 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.41E-28 | 319 | 387 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 33.545 | 322 | 387 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.3E-38 | 327 | 386 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.4E-25 | 329 | 385 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009409 | Biological Process | response to cold | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0070370 | Biological Process | cellular heat acclimation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 393 aa Download sequence Send to blast |
MSSTSFTDLL GSSGVDCYED DEDLRVSGSS FGGYYPERTG SGLPKFKTAQ PPPLPISQSS 60 HNFTFSDYLD SPLLLSSSHS LISPTTGTFP LQGFNGTTNN HSDFPWQLQS QPSNASSALQ 120 ETYGVQDHEK KQEMIPNEIA TQNNNQSFGT ERQIKIPAYM VSRNSNDGYG WRKYGQKQVK 180 KSENPRSYFK CTYPDCVSKK IVETASDGQI TEIIYKGGHN HPKPEFTKRP SQSSLPSSVN 240 GRRLFNPASV VSEPHDQSEN SSISFDYSDL EQKSFKSEYG EIDEEEEQPE MKRMKREGED 300 EGMSIEVSKG VKEPRVVVQT ISDIDVLIDG FRWRKYGQKV VKGNTNPRSY YKCTFQGCGV 360 KKQVERSAAD ERAVLTTYEG RHNHDIPTAL RRS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-32 | 318 | 387 | 8 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 5e-32 | 318 | 387 | 8 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.12235 | 0.0 | leaf| root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145360478 | 0.0 | ||||
Genevisible | 267246_at | 0.0 | ||||
Expression Atlas | AT2G30250 | - | ||||
AtGenExpress | AT2G30250 | - | ||||
ATTED-II | AT2G30250 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in roots and at lower levels in leaves, stems and seeds. {ECO:0000269|PubMed:18839316}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | member of WRKY Transcription Factor; Group I. Located in nucleus. Involved in response to various abiotic stresses - especially salt stress. | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY33 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Plays a partial role in heat stress tolerance (PubMed:19125253). Functions with WRKY26 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:19125253, ECO:0000269|PubMed:21336597}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00282 | DAP | 27203113 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G30250.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salt stress (PubMed:18839316). Induced by heat stress (PubMed:19125253). {ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:19125253}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator (A: Activate/R: Repress) | |||||
ATRM | AT5G59820 (A) |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT1G74310(A), AT2G14610(R), AT2G26150(A), AT4G36990(A), AT5G62020(A) |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | abscisic acid |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
IntAct | Search O22921 |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:18839316}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G30250 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF418309 | 0.0 | AF418309.1 Arabidopsis thaliana WRKY transcription factor 25 (WRKY25) mRNA, complete cds. | |||
GenBank | AY062720 | 0.0 | AY062720.1 Arabidopsis thaliana putative WRKY-type DNA binding protein (At2g30250; T9D9.6) mRNA, complete cds. | |||
GenBank | AY114650 | 0.0 | AY114650.1 Arabidopsis thaliana putative WRKY-type DNA binding protein (At2g30250) mRNA, complete cds. | |||
GenBank | AY136318 | 0.0 | AY136318.1 Arabidopsis thaliana putative WRKY-type DNA binding protein (At2g30250) mRNA, complete cds. | |||
GenBank | BT008482 | 0.0 | BT008482.1 Arabidopsis thaliana At2g30250 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_180584.1 | 0.0 | WRKY DNA-binding protein 25 | ||||
Swissprot | O22921 | 0.0 | WRK25_ARATH; Probable WRKY transcription factor 25 | ||||
TrEMBL | A0A178VTV3 | 0.0 | A0A178VTV3_ARATH; WRKY25 | ||||
STRING | AT2G30250.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM11603 | 17 | 33 | Representative plant | OGRP14 | 17 | 875 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G30250.1 |
Entrez Gene | 817575 |
iHOP | AT2G30250 |
wikigenes | AT2G30250 |