PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 171aa MW: 19104.1 Da PI: 4.9402

Description

basic leucine-zipper 2

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G18160.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	38.6	2.3e-12	31	87	5	61
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 ++ +r+ +NRe+ArrsR RK++ ++ L+ + +L++ N++ + l ++++ k ++ AT2G18160.1 31 RKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSNDNRQILNSLTVTSQLYMKIQA 87 57899*********************************8877777666666666555 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	2.8E-10	22	74	No hit	No description
SMART	SM00338	5.7E-16	27	91	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.197	29	92	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.4E-9	31	82	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	7.47E-12	31	82	No hit	No description
CDD	cd14702	5.15E-21	32	83	No hit	No description
PROSITE pattern	PS00036	0	34	49	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0020148	anatomy	shoot apical meristem
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001016	developmental stage	L mature pollen stage
PO:0001017	developmental stage	M germinated pollen stage

Sequence ? help Back to Top
Protein Sequence Length: 171 aa Download sequence Send to blast
MASSSSTYRS SSSSDGGNNN PSDSVVTVDE RKRKRMLSNR ESARRSRMRK QKHVDDLTAQ 60 INQLSNDNRQ ILNSLTVTSQ LYMKIQAENS VLTAQMEELS TRLQSLNEIV DLVQSNGAGF 120 GVDQIDGCGF DDRTVGIDGY YDDMNMMSNV NHWGGSVYTN QPIMANDINM Y

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	30	51	RKRKRMLSNRESARRSRMRKQK
2	43	50	RRSRMRKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.23493	0.0	flower\| root\| seed\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	10443480	0.0
Genevisible	263064_at	0.0
Expression Atlas	AT2G18160	-
AtGenExpress	AT2G18160	-
ATTED-II	AT2G18160	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in the shoot meristem during vegetative to reproductive phase transition. {ECO:0000269\|PubMed:22319055}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a b-ZIP transcription factor.
UniProt	Transcription factor that binds to specific DNA sequences in target gene promoters. BZIP2-BZIP63-KIN10 complex binds to the ETFQO promoter to up-regulate its transcription (PubMed:29348240). {ECO:0000250\|UniProtKB:O65683, ECO:0000269\|PubMed:29348240}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00267	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G18160.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G54620, AT3G62420, AT4G02640, AT5G24800, AT5G28770
IntAct	Search Q9SI15

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G18160

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC007212	0.0	AC007212.7 Arabidopsis thaliana chromosome 2 clone F8D23 map PhyB, complete sequence.
GenBank	AK230244	0.0	AK230244.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL23-13-A15.
GenBank	AY037216	0.0	AY037216.1 Arabidopsis thaliana At2g18160/F8D23.6 mRNA, complete cds.
GenBank	AY133545	0.0	AY133545.1 Arabidopsis thaliana At2g18160/F8D23.6 mRNA, complete cds.
GenBank	BT000700	0.0	BT000700.1 Arabidopsis thaliana clone RAFL08-13-K01 (R11176) putative bZIP transcription factor (At2g18160) mRNA, complete cds.
GenBank	CP002685	0.0	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_179408.1	1e-123	basic leucine-zipper 2
Swissprot	Q9SI15	1e-124	BZIP2_ARATH; bZIP transcription factor 2
TrEMBL	A0A178VSN6	1e-122	A0A178VSN6_ARATH; Uncharacterized protein
STRING	AT2G18160.1	1e-122	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM501	28	154
Representative plant	OGRP551	16	78

Link Out ? help Back to Top
Phytozome	AT2G18160.1
Entrez Gene	816329
iHOP	AT2G18160
wikigenes	AT2G18160

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Ekman DR,Lorenz WW,Przybyla AE,Wolfe NL,Dean JF SAGE analysis of transcriptome responses in Arabidopsis roots exposed to 2,4,6-trinitrotoluene. Plant Physiol., 2003. 133(3): p. 1397-406 [PMID:14551330] Dal Bosco C, et al. Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Schluepmann H, et al. Trehalose mediated growth inhibition of Arabidopsis seedlings is due to trehalose-6-phosphate accumulation. Plant Physiol., 2004. 135(2): p. 879-90 [PMID:15181209] Gong W, et al. Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes. Plant Physiol., 2004. 135(2): p. 773-82 [PMID:15208423] Deppmann CD, et al. Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] Scheible WR, et al. Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen. Plant Physiol., 2004. 136(1): p. 2483-99 [PMID:15375205] de Diego JG,David Rodr cDNA-AFLP analysis of seed germination in Arabidopsis thaliana identifies transposons and new genomic sequences. J. Plant Physiol., 2006. 163(4): p. 452-62 [PMID:16455359] Pischke MS,Huttlin EL,Hegeman AD,Sussman MR A transcriptome-based characterization of habituation in plant tissue culture. Plant Physiol., 2006. 140(4): p. 1255-78 [PMID:16489130] Ehlert A, et al. Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Plant J., 2006. 46(5): p. 890-900 [PMID:16709202] Deppmann CD,Alvania RS,Taparowsky EJ Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] Weltmeier F, et al. Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors. EMBO J., 2006. 25(13): p. 3133-43 [PMID:16810321] Cheng C, et al. An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice. BMC Genomics, 2007. 8: p. 175 [PMID:17577400] Hayden CA,Jorgensen RA Identification of novel conserved peptide uORF homology groups in Arabidopsis and rice reveals ancient eukaryotic origin of select groups and preferential association with transcription factor-encoding genes. BMC Biol., 2007. 5: p. 32 [PMID:17663791] Usadel B, et al. Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes. Plant Physiol., 2008. 146(4): p. 1834-61 [PMID:18305208] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Torti S, et al. Analysis of the Arabidopsis shoot meristem transcriptome during floral transition identifies distinct regulatory patterns and a leucine-rich repeat protein that promotes flowering. Plant Cell, 2012. 24(2): p. 444-62 [PMID:22319055] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]