PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

GRF

Protein Properties

Length: 244aa MW: 28210.6 Da PI: 8.7959

Description

growth-regulating factor 6

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G06200.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRC	76.5	2.7e-24	80	124	1	45
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 daepgrCrRtDGKkWRCs+++++++k+CErH+hrg++rs+++k + AT2G06200.1 80 DAEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSSSRKPP 124 79**************************************99875 PP
2	QLQ	59.6	9.1e-21	6	41	2	37
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 +FT +Q+++L++Q+l++KyLaan+PvPp+Ll+ i++ AT2G06200.1 6 PFTESQWEELENQALVFKYLAANMPVPPHLLFLIKR 41 8******************************99975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00951	3.2E-14	5	41	IPR014978	Glutamine-Leucine-Glutamine, QLQ
Pfam	PF08880	1.9E-15	6	39	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51666	22.628	6	41	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51667	24.005	80	124	IPR014977	WRC domain
Pfam	PF08879	2.3E-19	81	122	IPR014977	WRC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048366	Biological Process	leaf development
GO:0005634	Cellular Component	nucleus
GO:0005524	Molecular Function	ATP binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0009005	anatomy	root
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009052	anatomy	flower pedicel
PO:0020144	anatomy	apical meristem
PO:0025022	anatomy	collective leaf structure
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 244 aa Download sequence Send to blast
MATRIPFTES QWEELENQAL VFKYLAANMP VPPHLLFLIK RPFLFSSSSS SSSSSSFFSP 60 TLSPHFGWNV YEMGMGRKID AEPGRCRRTD GKKWRCSKEA YPDSKYCERH MHRGKNRSSS 120 RKPPPTQFTP NLFLDSSSRR RRSGYMDDFF SIEPSGSIKS CSGSAMEDND DGSCRGINNE 180 EKQPDRHCFI LGTDLRTRER PLMLEEKLKQ RDHDNEEEQG SKRFYRFLDE WPSSKSSVST 240 SLFI

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	265531_at	0.0
Expression Atlas	AT2G06200	-
AtGenExpress	AT2G06200	-
ATTED-II	AT2G06200	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269\|PubMed:20023165}.
Uniprot	TISSUE SPECIFICITY: Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips containing the shoot apical meristem (SAM) and flower buds. Also expressed in mature flowers, but weakly expressed in mature stems and leaves. {ECO:0000269\|PubMed:12974814}.

Functional Description ? help Back to Top
Source	Description
TAIR	Growth regulating factor encoding transcription activator. One of the nine members of a GRF gene family, containing nuclear targeting domain. Involved in leaf development and expressed in root, shoot and flower
UniProt	Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00263	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G06200.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G06200

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY060586	0.0	AY060586.1 Arabidopsis thaliana At2g06200/F5K7.4 mRNA, complete cds.
GenBank	AY125572	0.0	AY125572.1 Arabidopsis thaliana At2g06200/F5K7.4 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001325112.1	0.0	growth-regulating factor 6
Refseq	NP_027759.1	0.0	growth-regulating factor 6
Swissprot	Q9ZQ12	0.0	GRF6_ARATH; Growth-regulating factor 6
TrEMBL	A0A178VWJ6	1e-180	A0A178VWJ6_ARATH; GRF6
TrEMBL	A0A1P8B259	1e-180	A0A1P8B259_ARATH; Growth-regulating factor 6
STRING	AT2G06200.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM14101	18	21
Representative plant	OGRP460	16	84

Link Out ? help Back to Top
Phytozome	AT2G06200.1
Entrez Gene	815176
iHOP	AT2G06200
wikigenes	AT2G06200

Publications ? help Back to Top
Kim JH,Choi D,Kende H The AtGRF family of putative transcription factors is involved in leaf and cotyledon growth in Arabidopsis. Plant J., 2003. 36(1): p. 94-104 [PMID:12974814] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Kim JH,Kende H A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2004. 101(36): p. 13374-9 [PMID:15326298] Rodriguez RE, et al. Control of cell proliferation in Arabidopsis thaliana by microRNA miR396. Development, 2010. 137(1): p. 103-12 [PMID:20023165] Liang G,He H,Li Y,Wang F,Yu D Molecular mechanism of microRNA396 mediating pistil development in Arabidopsis. Plant Physiol., 2014. 164(1): p. 249-58 [PMID:24285851] Vercruyssen L, et al. ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development. Plant Cell, 2014. 26(1): p. 210-29 [PMID:24443518] Cao Y,Han Y,Jin Q,Lin Y,Cai Y Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa). Front Plant Sci, 2016. 7: p. 1750 [PMID:27933074]