![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G01930.2 | ||||||||
Common Name | ATBPC1, BBR, BPC1, F23I14.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 283aa MW: 31648 Da PI: 10.2151 | ||||||||
Description | basic pentacysteine1 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 371.3 | 1.8e-113 | 1 | 283 | 1 | 301 |
GAGA_bind 1 mdddgsrernkgyyepa..aslkenlglqlmssiaerdaki....rernlalsekkaavaerd..maflqrdkalaernkalverdnkllalllvens 90 mdddg+ rn+gyyepa +s+k nlglqlms+i +r++k+ re+nl ++++++++++r+ m++ +++++ ++dnk++++l++++ AT2G01930.2 1 MDDDGF--RNWGYYEPAaaSSFKGNLGLQLMSTI-DRNTKPflpgRESNL-MIGSNGSYHSREqdMNY----SWINQ------PKDNKFFNMLPIST- 83 99**99..9******99889**************.9**************.********998755999....*****......***********766. PP GAGA_bind 91 lasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesadersk 188 p++++vls+t+ +s+q++++p l+ s +e e+ +p +++++ k++k++ + +++++pk+kk++k+k+++++++++v++++ +r+k AT2G01930.2 84 -----PSYSNVLSETSGSNSIQMIHQPVLNSSRFE----ENPIPPPAPCEEQTGKKRKMRGSIATPTVPKAKKMRKPKEERDVTNNNVQQQQ--QRVK 170 .....99*******************999999888....445678899999****************************9999999999888..89** PP GAGA_bind 189 aekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLk 286 kks+dlv+ngvs+D+s+lPvPvC+CtG+++qCY+WG+GGWqSaCCtt+iSvyPLP+stkrrgaRi+grKmSqgafkk+LekL++eGy+++n++DLk AT2G01930.2 171 PVKKSVDLVINGVSMDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNISVYPLPMSTKRRGARISGRKMSQGAFKKVLEKLSTEGYSFGNAIDLK 268 ************************************************************************************************** PP GAGA_bind 287 dhWAkHGtnkfvtir 301 +hWA+HGtnkfvtir AT2G01930.2 269 SHWARHGTNKFVTIR 283 **************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01226 | 3.3E-180 | 1 | 283 | IPR010409 | GAGA-binding transcriptional activator |
Pfam | PF06217 | 2.1E-99 | 1 | 283 | IPR010409 | GAGA-binding transcriptional activator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0050793 | Biological Process | regulation of developmental process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000005 | anatomy | cultured plant cell | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001016 | developmental stage | L mature pollen stage | ||||
PO:0001017 | developmental stage | M germinated pollen stage | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 283 aa Download sequence Send to blast |
MDDDGFRNWG YYEPAAASSF KGNLGLQLMS TIDRNTKPFL PGRESNLMIG SNGSYHSREQ 60 DMNYSWINQP KDNKFFNMLP ISTPSYSNVL SETSGSNSIQ MIHQPVLNSS RFEENPIPPP 120 APCEEQTGKK RKMRGSIATP TVPKAKKMRK PKEERDVTNN NVQQQQQRVK PVKKSVDLVI 180 NGVSMDISGL PVPVCTCTGT PQQCYRWGCG GWQSACCTTN ISVYPLPMST KRRGARISGR 240 KMSQGAFKKV LEKLSTEGYS FGNAIDLKSH WARHGTNKFV TIR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.28559 | 0.0 | flower| leaf| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 263305_at | 0.0 | ||||
Expression Atlas | AT2G01930 | - | ||||
AtGenExpress | AT2G01930 | - | ||||
ATTED-II | AT2G01930 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Early detected in the floral meristem and floral organ primordia. At later stages, expressed in all floral organs and in particular in the ovule. {ECO:0000269|PubMed:15722463}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in leaf and sepal vasculature, in young rosette, in the lateral and tip of primary roots, and in the whole ovule. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | BASIC PENTACYSTEINE1 (BPC1) is a regulator of the homeotic Arabidopsis thaliana gene SEEDSTICK (STK), which controls ovule identity. BPC1 induces conformational changes by cooperative binding to purine-rich elements present in the STK regulatory sequence. STK is upregulated in bpc1 mutant. | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Negatively regulates the homeotic gene AGL11/STK, which controls ovule primordium identity, by a cooperative binding to purine-rich elements present in the regulatory sequence leading to DNA conformational changes. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:15722463}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00253 | DAP | 27203113 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G01930.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT4G09960(R) |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT2G01930, AT2G21240, AT5G42520 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G01930 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC007265 | 0.0 | AC007265.5 Arabidopsis thaliana chromosome 2 clone F23I14 map CIC11A04, complete sequence. | |||
GenBank | AY065225 | 0.0 | AY065225.1 Arabidopsis thaliana unknown protein (At2g01930) mRNA, complete cds. | |||
GenBank | AY096550 | 0.0 | AY096550.1 Arabidopsis thaliana unknown protein (At2g01930) mRNA, complete cds. | |||
GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_565279.1 | 0.0 | basic pentacysteine1 | ||||
Refseq | NP_973398.1 | 0.0 | basic pentacysteine1 | ||||
Swissprot | Q9SKD0 | 0.0 | BPC1_ARATH; Protein BASIC PENTACYSTEINE1 | ||||
TrEMBL | A0A178VWB7 | 0.0 | A0A178VWB7_ARATH; BPC1 | ||||
STRING | AT2G01930.2 | 0.0 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G01930.2 |
Entrez Gene | 814724 |
iHOP | AT2G01930 |
wikigenes | AT2G01930 |