PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G79430.2 | ||||||||
Common Name | APL, FE, PHL14, PHR2, T8K14.15, WDY | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 358aa MW: 39597.5 Da PI: 8.9827 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 107 | 1.1e-33 | 34 | 88 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl AT1G79430.2 34 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 88 79****************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.801 | 31 | 91 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-32 | 31 | 89 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.77E-16 | 33 | 89 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.3E-23 | 34 | 89 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.6E-8 | 36 | 86 | IPR001005 | SANT/Myb domain |
Pfam | PF14379 | 1.9E-21 | 129 | 169 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010088 | Biological Process | phloem development | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0006077 | anatomy | protophloem | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007057 | developmental stage | seed germination stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 358 aa Download sequence Send to blast |
MFHAKKPSSM NGSYENRAMC VQGDSGLVLT TDPKPRLRWT VELHERFVDA VAQLGGPDKA 60 TPKTIMRVMG VKGLTLYHLK SHLQKFRLGK QPHKEYGDHS TKEGSRASAM DIQRNVASSS 120 GMMSRNMNEM QMEVQRRLHE QLEVQRHLQL RIEAQGKYMQ SILERACQTL AGENMAAATA 180 AAAVGGGYKG NLGSSSLSAA VGPPPHPLSF PPFQDLNIYG NTTDQVLDHH NFHHQNIENH 240 FTGNNAADTN IYLGKKRPNP NFGNDVRKGL LMWSDQDHDL SANQSIDDEH RIQIQMATHV 300 STDLDSLSEI YERKSGLSGD EGNNGGKLLE RPSPRRSPLS PMMNPNGGLI QGRNSPFG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 2e-18 | 34 | 90 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 2e-18 | 34 | 90 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 2e-18 | 34 | 90 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 2e-18 | 34 | 90 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.23550 | 0.0 | bud| seed| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30699416 | 0.0 | ||||
Genevisible | 262921_at | 0.0 | ||||
Expression Atlas | AT1G79430 | - | ||||
AtGenExpress | AT1G79430 | - | ||||
ATTED-II | AT1G79430 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Specifically expressed in the developing protophloem sieve elements soon after the phloem-specific cell divisions have taken place. Also found in the companion cells and metaphloem sieve elements. May not be necessary for the initial steps of protophloem differentiation. {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in shoots and roots, specifically in the developing protophloem sieve elements (PubMed:14614507). Detected in phloem and/or cambium (PubMed:15923329). Expressed in the phloem tissues of various organs, including leaves and cotyledons, during vegetative growth (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:26239308}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes gene product that is required for several aspects of phloem development in the root: (1) the specific divisions organizing the phloem pole, (2) sieve element differentiation and (3) the expression of a companion-specific gene. Mutant has a defect in the organization of phloem poles in the root. apl seedlings have a short, determinate root with only occasional lateral branches. | |||||
UniProt | Transcription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G79430.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
IntAct | Search Q9SAK5 |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: Differentiation of tracheary-like elements of xyleme at the site of the phloem pole leading to seedling lethality. {ECO:0000269|PubMed:14614507}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G79430 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK316719 | 0.0 | AK316719.1 Arabidopsis thaliana AT1G79430 mRNA, complete cds, clone: RAFL09-57-C07. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_849905.1 | 0.0 | Homeodomain-like superfamily protein | ||||
Swissprot | Q9SAK5 | 0.0 | APL_ARATH; Myb family transcription factor APL | ||||
TrEMBL | D7KWH8 | 0.0 | D7KWH8_ARALL; Uncharacterized protein (Fragment) | ||||
STRING | AT1G79430.2 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5044 | 27 | 50 | Representative plant | OGRP78 | 17 | 262 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G79430.2 |
Entrez Gene | 844281 |
iHOP | AT1G79430 |
wikigenes | AT1G79430 |