PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB_related

Protein Properties

Length: 239aa MW: 26586.7 Da PI: 6.6834

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G74840.2	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	45.3	2e-14	97	141	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE++l++ + ++ G+g+Wk I+r + k+Rt q+ s+ qky AT1G74840.2 97 PWTEEEHKLFLLGLQRVGKGDWKGISRNFVKTRTSTQVASHAQKY 141 8*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.102	90	146	IPR017930	Myb domain
SuperFamily	SSF46689	2.87E-17	92	147	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	3.1E-17	93	144	IPR006447	Myb domain, plants
SMART	SM00717	1.2E-9	94	144	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-10	96	141	IPR009057	Homeodomain-like
CDD	cd00167	4.64E-9	97	142	No hit	No description
Pfam	PF00249	2.7E-11	97	141	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006338	Biological Process	chromatin remodeling
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0035066	Biological Process	positive regulation of histone acetylation
GO:0046686	Biological Process	response to cadmium ion
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003682	Molecular Function	chromatin binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0003713	Molecular Function	transcription coactivator activity
GO:0004402	Molecular Function	histone acetyltransferase activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 239 aa Download sequence Send to blast
MADGSTSSSE STTACAGSGT RREIMLFGVR VVLDPMRKCV SLNNLSDYEQ TAETPKIDGE 60 DRDEQDMNKT PAGYASADEA LPMSSSNGKI ERKRGVPWTE EEHKLFLLGL QRVGKGDWKG 120 ISRNFVKTRT STQVASHAQK YFLRRSNLNR RRRRSSLFDM TTDTVIPMEE DHQVLIQENT 180 SQSSSPVPEI NNFSIHPVMQ VFPEFPVPTG NQSYGQLTSS NLNEPSPSMH PAFNTIGVA

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.11594	0.0	flower\| root\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	262166_at	0.0
Expression Atlas	AT1G74840	-
AtGenExpress	AT1G74840	-
ATTED-II	AT1G74840	-

Functional Description ? help Back to Top
Source	Description
UniProt	Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269\|PubMed:21030505}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00236	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G74840.2

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269\|PubMed:21030505}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G74840

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK318855	0.0	AK318855.1 Arabidopsis thaliana AT1G74840 mRNA, complete cds, clone: RAFL16-10-L11.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001185398.1	1e-180	Homeodomain-like superfamily protein
Swissprot	Q2V9B0	4e-55	MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBL	C0Z2P1	1e-179	C0Z2P1_ARATH; AT1G74840 protein
STRING	AT1G74840.1	1e-152	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT1G74840.2
Entrez Gene	843823
iHOP	AT1G74840
wikigenes	AT1G74840

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Dal Bosco C, et al. Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] Jiao Y, et al. A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development. Plant Physiol., 2003. 133(4): p. 1480-93 [PMID:14605227] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Pischke MS,Huttlin EL,Hegeman AD,Sussman MR A transcriptome-based characterization of habituation in plant tissue culture. Plant Physiol., 2006. 140(4): p. 1255-78 [PMID:16489130] Usadel B, et al. Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes. Plant Physiol., 2008. 146(4): p. 1834-61 [PMID:18305208] Gutiérrez RA, et al. Systems approach identifies an organic nitrogen-responsive gene network that is regulated by the master clock control gene CCA1. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(12): p. 4939-44 [PMID:18344319] Shin D, et al. Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance. Plant Physiol., 2011. 155(1): p. 421-32 [PMID:21030505] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944]