PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WRKY

Protein Properties

Length: 287aa MW: 32042.1 Da PI: 6.7027

Description

WRKY DNA-binding protein 57

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G69310.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	105.2	3.5e-33	147	204	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers++dp++v++tYeg+H h+ AT1G69310.1 147 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSRCTVKKRVERSSDDPSIVITTYEGQHCHQ 204 8********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.0E-34	131	205	IPR003657	WRKY domain
SuperFamily	SSF118290	1.57E-28	138	204	IPR003657	WRKY domain
PROSITE profile	PS50811	29.838	141	206	IPR003657	WRKY domain
SMART	SM00774	6.8E-39	146	205	IPR003657	WRKY domain
Pfam	PF03106	2.5E-26	147	204	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 287 aa Download sequence Send to blast
MNDPDNPDLS NDDSAWRELT LTAQDSDFFD RDTSNILSDF GWNLHHSSDH PHSLRFDSDL 60 TQTTGVKPTT VTSSCSSSAA VSVAVTSTNN NPSATSSSSE DPAENSTASA EKTPPPETPV 120 KEKKKAQKRI RQPRFAFMTK SDVDNLEDGY RWRKYGQKAV KNSPFPRSYY RCTNSRCTVK 180 KRVERSSDDP SIVITTYEGQ HCHQTIGFPR GGILTAHDPH SFTSHHHLPP PLPNPYYYQE 240 LLHQLHRDNN APSPRLPRPT TEDTPAVSTP SEEGLLGDIV PQTMRNP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-25	136	203	7	74	Probable WRKY transcription factor 4
2lex_A	2e-25	136	203	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	260337_at	0.0
Expression Atlas	AT1G69310	-
AtGenExpress	AT1G69310	-
ATTED-II	AT1G69310	-

Functional Description ? help Back to Top
Source	Description
TAIR	member of WRKY Transcription Factor; Group II-c
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
the functions of WRKY57 [PMID: 22930734] JA-induced leaf senescence process can be antagonized by auxin via WRKY57. [PMID: 24424094] loss of function of WRKY57 enhanced the resistance of Arabidopsis (Arabidopsis thaliana) against Botrytis cinerea infection. [PMID: 27268959]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00067	PBM	25215497	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G69310.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G69310

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY071849	0.0	AY071849.1 Arabidopsis thaliana WRKY transcription factor 57 (WRKY57) mRNA, complete cds.
GenBank	BT026057	0.0	BT026057.1 Arabidopsis thaliana At1g69310 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001321561.1	0.0	WRKY DNA-binding protein 57
Refseq	NP_177090.1	0.0	WRKY DNA-binding protein 57
Refseq	NP_974112.1	0.0	WRKY DNA-binding protein 57
Swissprot	Q9C983	0.0	WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBL	Q147N6	0.0	Q147N6_ARATH; At1g69310
STRING	AT1G69310.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4995	27	53
Representative plant	OGRP14	17	875

Link Out ? help Back to Top
Phytozome	AT1G69310.1
Entrez Gene	843262
iHOP	AT1G69310
wikigenes	AT1G69310

Publications ? help Back to Top
Eulgem T,Rushton PJ,Robatzek S,Somssich IE The WRKY superfamily of plant transcription factors. Trends Plant Sci., 2000. 5(5): p. 199-206 [PMID:10785665] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Brodersen P, et al. Arabidopsis MAP kinase 4 regulates salicylic acid- and jasmonic acid/ethylene-dependent responses via EDS1 and PAD4. Plant J., 2006. 47(4): p. 532-46 [PMID:16813576] Jiang Y,Liang G,Yu D Activated expression of WRKY57 confers drought tolerance in Arabidopsis. Mol Plant, 2012. 5(6): p. 1375-88 [PMID:22930734] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jiang Y,Liang G,Yang S,Yu D Arabidopsis WRKY57 functions as a node of convergence for jasmonic acid- and auxin-mediated signaling in jasmonic acid-induced leaf senescence. Plant Cell, 2014. 26(1): p. 230-45 [PMID:24424094] Jiang Y,Qiu Y,Hu Y,Yu D Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa. Front Plant Sci, 2016. 7: p. 145 [PMID:26904091] Jiang Y,Yu D The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance. Plant Physiol., 2016. 171(4): p. 2771-82 [PMID:27268959] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]