|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
AT1G66380.1 |
Common Name | AtMYB114, MYB114, T27F4.13 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
Family |
MYB |
Protein Properties |
Length: 139aa MW: 16006.7 Da PI: 10.9187 |
Description |
myb domain protein 114 |
Gene Model |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 52.6 | 1.1e-16 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
AT1G66380.1 10 KGAWTAEEDSLLRQCIGKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
79*********************************************7 PP
|
2 | Myb_DNA-binding | 53.5 | 5.5e-17 | 63 | 108 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+++ +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
AT1G66380.1 63 RGKFSSDEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
89********************.*********.************996 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter |
GO:0007275 | Biological Process | multicellular organism development |
GO:0009753 | Biological Process | response to jasmonic acid |
GO:0030154 | Biological Process | cell differentiation |
GO:0031540 | Biological Process | regulation of anthocyanin biosynthetic process |
GO:0005634 | Cellular Component | nucleus |
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding |
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
Protein Sequence Length: 139 aa
Download sequence Send
to blast |
MEGSSKGLRK GAWTAEEDSL LRQCIGKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPS 60 IKRGKFSSDE VDLLLRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHEPCCKTKI 120 KRINIITPPN TPAQKVDIF
|
Functional Description ? help
Back to Top |
Source |
Description |
TAIR | Encodes a member of the MYB family of transcription factors. Involved in regulation of anthocyanin biosynthesis. Affects the expression of enzymes involved in later steps of anthocyanin biosynthesis |
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Function -- GeneRIF ? help
Back to Top |
- This study showed that overexpression of Myb113 or Myb114 results in substantial increases in pigment production, and that pigment production remains TTG1- and bHLH-dependent.
[PMID: 18036197]
|
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AY008379 | 0.0 | AY008379.1 Arabidopsis thaliana putative transcription factor MYB114 mRNA, complete cds. |
GenBank | AY519567 | 0.0 | AY519567.1 Arabidopsis thaliana MYB transcription factor (At1g66380) mRNA, complete cds. |
Orthologous Group
? help Back to Top |
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Representative plant | OGRP5 | 17 | 1784 |
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. Plant J., 2004. 40(1): p. 22-34 [PMID:15361138] - Scheible WR, et al.
Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen. Plant Physiol., 2004. 136(1): p. 2483-99 [PMID:15375205] - Downie A, et al.
Expression profiling of the response of Arabidopsis thaliana to methanol stimulation. Phytochemistry, 2004. 65(16): p. 2305-16 [PMID:15381001] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] - Gonzalez A,Zhao M,Leavitt JM,Lloyd AM
Regulation of the anthocyanin biosynthetic pathway by the TTG1/bHLH/Myb transcriptional complex in Arabidopsis seedlings. Plant J., 2008. 53(5): p. 814-27 [PMID:18036197] - Heppel SC, et al.
Identification of key amino acids for the evolution of promoter target specificity of anthocyanin and proanthocyanidin regulating MYB factors. Plant Mol. Biol., 2013. 82(4-5): p. 457-71 [PMID:23689818] - Li S,Zachgo S
TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana. Plant J., 2013. 76(6): p. 901-13 [PMID:24118612] - Li T, et al.
Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis. Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83 [PMID:25450360] - Mondal SK,Roy S
Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]
|