PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G65330.1

Common Name

AGL37, PHE1, T8F5.11

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

M-type_MADS

Protein Properties

Length: 279aa MW: 31953.4 Da PI: 5.0952

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G65330.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	51.7	1.1e-16	9	55	2	48
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 +ien+s r++tf+kR++g+lKK +EL +LC+++++ +i s+ + ++e AT1G65330.1 9 FIENDSVRKTTFTKRKKGMLKKFNELVTLCGVDACAVIRSPYNSIQE 55 8***************************************9998876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	16.778	1	55	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.5E-23	1	59	IPR002100	Transcription factor, MADS-box
CDD	cd00266	7.06E-31	1	84	No hit	No description
PRINTS	PR00404	5.6E-8	2	22	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.06E-22	2	94	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.2E-16	9	52	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.6E-8	22	37	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009793	Biological Process	embryo development ending in seed dormancy
GO:0005634	Cellular Component	nucleus
GO:0090406	Cellular Component	pollen tube
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000423	anatomy	plant zygote
PO:0006334	anatomy	seed micropyle
PO:0009009	anatomy	plant embryo
PO:0009089	anatomy	endosperm
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage

Sequence ? help Back to Top
Protein Sequence Length: 279 aa Download sequence Send to blast
MRGKMKLSFI ENDSVRKTTF TKRKKGMLKK FNELVTLCGV DACAVIRSPY NSIQEPWPSR 60 EGVEEVMSKF MEFSVLDRTK KMVDQETFLR QRIAKETERL QKLRDENRNS QIRDLMFGCL 120 KGEVDVSHLH GRDLLDLNVF LNKYLNGVIR RVEILKENGE SSSSVPPPIG VAPTVVDASV 180 PIGFDGRMIQ DQNQNQQEPV QFQYQALYDF YDQIPKKLHD FNMKMNIDPN QSMNLDLNDG 240 EDEGIPCMDN NNYHPEIDCL ATVTTAPTDV CAPNIINDL

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	264214_s_at	1e-117
Expression Atlas	AT1G65330	-
AtGenExpress	AT1G65330	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Not present in female gametophyte before fertilization. Expressed in pollen tube and at the micropylar pole of pollinated seeds. {ECO:0000269\|PubMed:15619622}.
Uniprot	TISSUE SPECIFICITY: Male gametophyte, embryo and endosperm. {ECO:0000269\|PubMed:12815071, ECO:0000269\|PubMed:15619622}.

Functional Description ? help Back to Top
Source	Description
TAIR	Type I MADS-box protein, regulated by MEA and FIE, expressed transiently after fertilization in embryo and endosperm.
UniProt	Probable transcription factor involved in the development of gametophytes and seeds. {ECO:0000269\|PubMed:12815071}.

Function -- GeneRIF ? help Back to Top
Evidence that silencing of the maternal PHERES1 allele depends on a distantly located region downstream of the PHERES1 locus. [PMID: 18303047] AtUBP26 is required for normal seed development and the repression of PHE1 [PMID: 18723879] Study shows that PHERES1 is regulated by genomic imprinting, which is likely caused by the presence of repeat sequences in the proximity of the PHERES1 locus. [PMID: 19825646]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G65330.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by MEA, FIS2 and FIE in seeds, and by PKL after germination. {ECO:0000269\|PubMed:12815071, ECO:0000269\|PubMed:16359393}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
IntAct	Search O80805

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G65330

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP002684	0.0	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBank	T8F5	0.0	AC004512.2 Arabidopsis thaliana chromosome 1 BAC T8F5 sequence, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_176712.1	0.0	MADS-box transcription factor family protein
Swissprot	O80805	0.0	PHE1_ARATH; MADS-box transcription factor PHERES 1
TrEMBL	A0A178W2S5	0.0	A0A178W2S5_ARATH; PHE1
STRING	AT1G65330.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM70	28	415
Representative plant	OGRP114	13	173

Link Out ? help Back to Top
Phytozome	AT1G65330.1
Entrez Gene	842841
iHOP	AT1G65330
wikigenes	AT1G65330

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Shepard KA,Purugganan MD Molecular population genetics of the Arabidopsis CLAVATA2 region. The genomic scale of variation and selection in a selfing species. Genetics, 2003. 163(3): p. 1083-95 [PMID:12663546] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Köhler C, et al. The Polycomb-group protein MEDEA regulates seed development by controlling expression of the MADS-box gene PHERES1. Genes Dev., 2003. 17(12): p. 1540-53 [PMID:12815071] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Katz A,Oliva M,Mosquna A,Hakim O,Ohad N FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development. Plant J., 2004. 37(5): p. 707-19 [PMID:14871310] Yadegari R,Drews GN Female gametophyte development. Plant Cell, 2004. 16 Suppl: p. S133-41 [PMID:15075395] K The Arabidopsis thaliana MEDEA Polycomb group protein controls expression of PHERES1 by parental imprinting. Nat. Genet., 2005. 37(1): p. 28-30 [PMID:15619622] Autran D,Huanca-Mamani W,Vielle-Calzada JP Genomic imprinting in plants: the epigenetic version of an Oedipus complex. Curr. Opin. Plant Biol., 2005. 8(1): p. 19-25 [PMID:15653395] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Ingouff M,Haseloff J,Berger F Polycomb group genes control developmental timing of endosperm. Plant J., 2005. 42(5): p. 663-74 [PMID:15918881] Li HC, et al. PICKLE acts during germination to repress expression of embryonic traits. Plant J., 2005. 44(6): p. 1010-22 [PMID:16359393] Baroux C,Gagliardini V,Page DR,Grossniklaus U Dynamic regulatory interactions of Polycomb group genes: MEDEA autoregulation is required for imprinted gene expression in Arabidopsis. Genes Dev., 2006. 20(9): p. 1081-6 [PMID:16651654] Josefsson C,Dilkes B,Comai L Parent-dependent loss of gene silencing during interspecies hybridization. Curr. Biol., 2006. 16(13): p. 1322-8 [PMID:16824920] Makarevich G, et al. Different Polycomb group complexes regulate common target genes in Arabidopsis. EMBO Rep., 2006. 7(9): p. 947-52 [PMID:16878125] Perruc E,Kinoshita N,Lopez-Molina L The role of chromatin-remodeling factor PKL in balancing osmotic stress responses during Arabidopsis seed germination. Plant J., 2007. 52(5): p. 927-36 [PMID:17892443] Ngo QA,Moore JM,Baskar R,Grossniklaus U,Sundaresan V Arabidopsis GLAUCE promotes fertilization-independent endosperm development and expression of paternally inherited alleles. Development, 2007. 134(22): p. 4107-17 [PMID:17965055] Makarevich G,Villar CB,Erilova A,Köhler C Mechanism of PHERES1 imprinting in Arabidopsis. J. Cell. Sci., 2008. 121(Pt 6): p. 906-12 [PMID:18303047] Huh JH,Bauer MJ,Hsieh TF,Fischer RL Cellular programming of plant gene imprinting. Cell, 2008. 132(5): p. 735-44 [PMID:18329361] Bemer M,Wolters-Arts M,Grossniklaus U,Angenent GC The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules. Plant Cell, 2008. 20(8): p. 2088-101 [PMID:18713950] Luo M, et al. UBIQUITIN-SPECIFIC PROTEASE 26 is required for seed development and the repression of PHERES1 in Arabidopsis. Genetics, 2008. 180(1): p. 229-36 [PMID:18723879] Miyake T,Takebayashi N,Wolf DE Possible diversifying selection in the imprinted gene, MEDEA, in Arabidopsis. Mol. Biol. Evol., 2009. 26(4): p. 843-57 [PMID:19126870] Villar CB,Erilova A,Makarevich G,Tr Control of PHERES1 imprinting in Arabidopsis by direct tandem repeats. Mol Plant, 2009. 2(4): p. 654-60 [PMID:19825646] Jullien PE,Berger F Parental genome dosage imbalance deregulates imprinting in Arabidopsis. PLoS Genet., 2010. 6(3): p. e1000885 [PMID:20333248] Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis. Plant Physiol., 2010. 154(1): p. 287-300 [PMID:20631316] Ishikawa R, et al. Rice interspecies hybrids show precocious or delayed developmental transitions in the endosperm without change to the rate of syncytial nuclear division. Plant J., 2011. 65(5): p. 798-806 [PMID:21251103] Schmidt A, et al. The Polycomb group protein MEDEA and the DNA methyltransferase MET1 interact to repress autonomous endosperm development in Arabidopsis. Plant J., 2013. 73(5): p. 776-87 [PMID:23146178] Raissig MT,Bemer M,Baroux C,Grossniklaus U Genomic imprinting in the Arabidopsis embryo is partly regulated by PRC2. PLoS Genet., 2013. 9(12): p. e1003862 [PMID:24339783] Jeong CW, et al. Control of Paternally Expressed Imprinted UPWARD CURLY LEAF1, a Gene Encoding an F-Box Protein That Regulates CURLY LEAF Polycomb Protein, in the Arabidopsis Endosperm. PLoS ONE, 2015. 10(2): p. e0117431 [PMID:25689861] Burkart-Waco D,Ngo K,Lieberman M,Comai L Perturbation of parentally biased gene expression during interspecific hybridization. PLoS ONE, 2015. 10(2): p. e0117293 [PMID:25719202] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]