PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

M-type_MADS

Protein Properties

Length: 284aa MW: 32159 Da PI: 6.3899

Description

AGAMOUS-like 49

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G60040.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	35	1.9e-11	23	63	10	50
HHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 10 qvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 q f +R g KKA+ELSvLC+ v i +++++ l+ ++ AT1G60040.1 23 QSFFKQRFPGFKKKASELSVLCGNSVGFICYGPDNDLHVWP 63 445666888999****************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd00266	2.37E-20	7	91	No hit	No description
SuperFamily	SSF55455	1.96E-13	20	98	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.8E-10	20	62	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	10.806	21	66	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009052	anatomy	flower pedicel
PO:0020090	anatomy	embryo sac central cell
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001017	developmental stage	M germinated pollen stage

Sequence ? help Back to Top
Protein Sequence Length: 284 aa Download sequence Send to blast
MAPRQKKPNK SDDDDGDLHR KKQSFFKQRF PGFKKKASEL SVLCGNSVGF ICYGPDNDLH 60 VWPQSQDHNP QALHEIVAKF NALSDERRKN HACDLNDFPH HLKGLSREEL RKHLLHLDSQ 120 LLGVREQKIE ILKKTLTGSS EKDGARVSEN SAISDHKLKI EPNLTDILSE DHLIRVSDKK 180 LGSCDVFDEL AYVVRGSRNL NENVSNYESK DAAYTGMDHL GTFGGNYLQE AAAELYQTYN 240 LGNFCDDHVW DLEFASRLPP LHTFSDPLMT TNTCQTMSSD MISI

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	263735_s_at	0.0
Expression Atlas	AT1G60040	-
AtGenExpress	AT1G60040	-

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305\|PubMed:26462908}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G60040.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q9ZUI9

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G60040

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP002684	0.0	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBank	T2K10	0.0	AC005966.2 Arabidopsis thaliana chromosome 1 BAC T2K10 sequence, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_176212.1	0.0	AGAMOUS-like 49
Swissprot	Q9ZUI9	0.0	AGL49_ARATH; Agamous-like MADS-box protein AGL49
TrEMBL	A0A178W4C9	0.0	A0A178W4C9_ARATH; AGL49
STRING	AT1G60040.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM11232	9	28

Link Out ? help Back to Top
Phytozome	AT1G60040.1
Entrez Gene	842298
iHOP	AT1G60040
wikigenes	AT1G60040

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] Guan Y,Nothnagel EA Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis. Plant Physiol., 2010. 154(1): p. 287-300 [PMID:20631316] Li HJ, et al. Arabidopsis CBP1 Is a Novel Regulator of Transcription Initiation in Central Cell-Mediated Pollen Tube Guidance. Plant Cell, 2015. 27(10): p. 2880-93 [PMID:26462908] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]