PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

Dof

Protein Properties

Length: 194aa MW: 21682.2 Da PI: 8.9374

Description

DOF zinc finger protein 1

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G51700.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	127	5.7e-40	29	89	2	62
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rk++k+s AT1G51700.1 29 EQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGTRKSNKRS 89 57899***************************************************99875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	3.0E-27	19	83	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	5.2E-33	31	87	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	29.404	33	87	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	35	71	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010200	Biological Process	response to chitin
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding
GO:0046872	Molecular Function	metal ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 194 aa Download sequence Send to blast
MQDLTSAAAY YHQSMMMTTA KQNQPELPEQ EQLKCPRCDS PNTKFCYYNN YNLSQPRHFC 60 KNCRRYWTKG GALRNIPVGG GTRKSNKRSG SSPSSNLKNQ TVAEKPDHHG SGSEEKEERV 120 SGQEMNPTRM LYGLPVGDPN GASFSSLLAS NMQMGGLVYE SGSRWLPGMD LGLGSVRRSD 180 DTWTDLAMNR MEKN

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.256	0.0	cell culture\| leaf\| root\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	42562686	0.0
Genevisible	256185_at	0.0
Expression Atlas	AT1G51700	-
AtGenExpress	AT1G51700	-
ATTED-II	AT1G51700	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes dof zinc finger protein (adof1).
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00199	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G51700.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT5G15840(R)

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G51700

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB017564	0.0	AB017564.1 Arabidopsis thaliana adof1 mRNA for dof zinc finger protein, complete cds.
GenBank	AC025294	0.0	AC025294.14 Arabidopsis thaliana chromosome 1 BAC F19C24 genomic sequence, complete sequence.
GenBank	AK229106	0.0	AK229106.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-39-C17.
GenBank	BT025772	0.0	BT025772.1 Arabidopsis thaliana At1g51700 mRNA, complete cds.
GenBank	CP002684	0.0	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_175581.1	1e-145	DOF zinc finger protein 1
Swissprot	O82155	1e-146	DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBL	A0A384L6K9	1e-144	A0A384L6K9_ARATH; DOF1
TrEMBL	Q1ECG2	1e-144	Q1ECG2_ARATH; At1g51700
STRING	AT1G51700.1	1e-144	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1269	28	96
Representative plant	OGRP38	17	445

Link Out ? help Back to Top
Phytozome	AT1G51700.1
Entrez Gene	841595
iHOP	AT1G51700
wikigenes	AT1G51700

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yanagisawa S The Dof family of plant transcription factors. Trends Plant Sci., 2002. 7(12): p. 555-60 [PMID:12475498] Park DH, et al. The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling. Plant J., 2003. 34(2): p. 161-71 [PMID:12694592] Lijavetzky D,Carbonero P,Vicente-Carbajosa J Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families. BMC Evol. Biol., 2003. 3: p. 17 [PMID:12877745] Vlieghe K, et al. Microarray analysis of E2Fa-DPa-overexpressing plants uncovers a cross-talking genetic network between DNA replication and nitrogen assimilation. J. Cell. Sci., 2003. 116(Pt 20): p. 4249-59 [PMID:12953064] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ma S,Gong Q,Bohnert HJ Dissecting salt stress pathways. J. Exp. Bot., 2006. 57(5): p. 1097-107 [PMID:16510518] Rajagopalan R,Vaucheret H,Trejo J,Bartel DP A diverse and evolutionarily fluid set of microRNAs in Arabidopsis thaliana. Genes Dev., 2006. 20(24): p. 3407-25 [PMID:17182867] Libault M,Wan J,Czechowski T,Udvardi M,Stacey G Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] Hayama R,Agashe B,Luley E,King R,Coupland G A circadian rhythm set by dusk determines the expression of FT homologs and the short-day photoperiodic flowering response in Pharbitis. Plant Cell, 2007. 19(10): p. 2988-3000 [PMID:17965272] Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM Light has a specific role in modulating Arabidopsis gene expression at low temperature. BMC Plant Biol., 2008. 8: p. 13 [PMID:18230142] Huang D,Wu W,Abrams SR,Cutler AJ The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. J. Exp. Bot., 2008. 59(11): p. 2991-3007 [PMID:18552355] Gaudinier A, et al. Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178]