PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NF-YA

Protein Properties

Length: 190aa MW: 21299.7 Da PI: 9.2457

Description

nuclear factor Y, subunit A7

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G30500.2	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CBFB_NFYA	106.3	2.6e-33	99	155	1	58
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Ra+le+++k+ +ksrkpylheSRh hA+rRpRg+gGrF AT1G30500.2 99 EEPVFVNAKQYHGILRRRQSRARLESQNKV-IKSRKPYLHESRHLHAIRRPRGCGGRF 155 69**************************.************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00521	1.8E-37	97	158	IPR001289	Nuclear transcription factor Y subunit A
PROSITE profile	PS51152	38.39	98	158	IPR001289	Nuclear transcription factor Y subunit A
Pfam	PF02045	2.3E-27	100	155	IPR001289	Nuclear transcription factor Y subunit A
PRINTS	PR00616	7.2E-24	101	123	IPR001289	Nuclear transcription factor Y subunit A
PRINTS	PR00616	7.2E-24	132	155	IPR001289	Nuclear transcription factor Y subunit A

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0016602	Cellular Component	CCAAT-binding factor complex
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 190 aa Download sequence Send to blast
MTSSIHELSD NIGSHEKQEQ RDSHFQPPIP SARNYESIVT SLVYSDPGTT NSMAPGQYPY 60 PDPYYRSIFA PPPQPYTGVH LQLMGVQQQG VPLPSDAVEE PVFVNAKQYH GILRRRQSRA 120 RLESQNKVIK SRKPYLHESR HLHAIRRPRG CGGRFLNAKK EDEHHEDSSH EEKSNLSAGK 180 SAMAASSGTS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4awl_A	5e-22	98	165	1	68	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.40538	0.0	flower\| leaf\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	261803_at	1e-176
Expression Atlas	AT1G30500	-
AtGenExpress	AT1G30500	-
ATTED-II	AT1G30500	-

Functional Description ? help Back to Top
Source	Description
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G30500.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G54830, AT1G56170
IntAct	Search Q84JP1

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G30500

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT004274	0.0	BT004274.1 Arabidopsis thaliana clone RAFL15-46-O22 (R50095) putative transcription factor (At1g30500) mRNA, complete cds.
GenBank	BT005561	0.0	BT005561.1 Arabidopsis thaliana clone U50095 putative transcription factor (At1g30500) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_849733.1	1e-139	nuclear factor Y, subunit A7
Swissprot	Q84JP1	1e-140	NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBL	F4I6C2	1e-132	F4I6C2_ARATH; Nuclear factor Y, subunit A7
STRING	AT1G30500.2	1e-139	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4168	27	56
Representative plant	OGRP680	16	72

Link Out ? help Back to Top
Phytozome	AT1G30500.2
Entrez Gene	839929
iHOP	AT1G30500
wikigenes	AT1G30500

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Gusmaroli G,Tonelli C,Mantovani R Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits. Gene, 2002. 283(1-2): p. 41-8 [PMID:11867211] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Rizhsky L, et al. When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress. Plant Physiol., 2004. 134(4): p. 1683-96 [PMID:15047901] M Genome-wide analysis of the Arabidopsis leaf transcriptome reveals interaction of phosphate and sugar metabolism. Plant Physiol., 2007. 143(1): p. 156-71 [PMID:17085508] Bi YM,Wang RL,Zhu T,Rothstein SJ Global transcription profiling reveals differential responses to chronic nitrogen stress and putative nitrogen regulatory components in Arabidopsis. BMC Genomics, 2007. 8: p. 281 [PMID:17705847] Peng M,Bi YM,Zhu T,Rothstein SJ Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA. Plant Mol. Biol., 2007. 65(6): p. 775-97 [PMID:17885809] Yamamoto A, et al. Arabidopsis NF-YB subunits LEC1 and LEC1-LIKE activate transcription by interacting with seed-specific ABRE-binding factors. Plant J., 2009. 58(5): p. 843-56 [PMID:19207209] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Hackenberg D, et al. Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y. Mol Plant, 2012. 5(4): p. 876-88 [PMID:22199235] Leyva-Gonz Functional and transcriptome analysis reveals an acclimatization strategy for abiotic stress tolerance mediated by Arabidopsis NF-YA family members. PLoS ONE, 2012. 7(10): p. e48138 [PMID:23118940] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]