![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G30500.1 | ||||||||
Common Name | NF-YA7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 186aa MW: 20822.1 Da PI: 9.2451 | ||||||||
Description | nuclear factor Y, subunit A7 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 106.4 | 2.5e-33 | 95 | 151 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Ra+le+++k+ +ksrkpylheSRh hA+rRpRg+gGrF AT1G30500.1 95 EEPVFVNAKQYHGILRRRQSRARLESQNKV-IKSRKPYLHESRHLHAIRRPRGCGGRF 151 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.8E-37 | 93 | 154 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.39 | 94 | 154 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.2E-27 | 96 | 151 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 7.1E-24 | 97 | 119 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 7.1E-24 | 128 | 151 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MTSSIHELSD NIGSHEKQEQ RDSHFQPPIP SARNYESIVT SLVYSDPGTT NSMAPGQYPY 60 PDPYYRSIFA PPPQPYTGLM GVQQQGVPLP SDAVEEPVFV NAKQYHGILR RRQSRARLES 120 QNKVIKSRKP YLHESRHLHA IRRPRGCGGR FLNAKKEDEH HEDSSHEEKS NLSAGKSAMA 180 ASSGTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 4e-22 | 94 | 161 | 1 | 68 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.40538 | 0.0 | flower| leaf| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 261803_at | 1e-176 | ||||
Expression Atlas | AT1G30500 | - | ||||
AtGenExpress | AT1G30500 | - | ||||
ATTED-II | AT1G30500 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G30500.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT1G54830, AT1G56170 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G30500 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT004274 | 0.0 | BT004274.1 Arabidopsis thaliana clone RAFL15-46-O22 (R50095) putative transcription factor (At1g30500) mRNA, complete cds. | |||
GenBank | BT005561 | 0.0 | BT005561.1 Arabidopsis thaliana clone U50095 putative transcription factor (At1g30500) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_174338.2 | 1e-136 | nuclear factor Y, subunit A7 | ||||
Swissprot | Q84JP1 | 1e-135 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | F4I6C2 | 1e-135 | F4I6C2_ARATH; Nuclear factor Y, subunit A7 | ||||
STRING | AT1G30500.2 | 1e-133 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G30500.1 |
Entrez Gene | 839929 |
iHOP | AT1G30500 |
wikigenes | AT1G30500 |