PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 335aa MW: 38278.7 Da PI: 4.6411

Description

AGAMOUS-like 104

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G22130.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	84.3	7.5e-27	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++++l +s AT1G22130.1 9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSDRLSLFS 58 79******************************************998776 PP
2	K-box	19.2	5.2e-08	122	191	10	79
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqiee 79 +++ e+l++e+ +L++++++ ++e+R++ + + +++e + e+qL + l+++ +++++l+ ++++ AT1G22130.1 122 INSDVEELEHEVCRLQQQLQMAEEELRRYEPDPIRFTTMEEYEVSEKQLLDTLTHVVQRRDHLMSNHLSS 191 5678999**********************************************************99875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	28.973	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	3.0E-36	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.99E-34	2	75	No hit	No description
SuperFamily	SSF55455	7.72E-29	2	82	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.9E-25	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.3E-24	10	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.9E-25	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.9E-25	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010152	Biological Process	pollen maturation
GO:0080092	Biological Process	regulation of pollen tube growth
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0025022	anatomy	collective leaf structure
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001016	developmental stage	L mature pollen stage
PO:0001017	developmental stage	M germinated pollen stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 335 aa Download sequence Send to blast
MGRVKLEIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SDRLSLFSGK 60 TRIEDVFSRF INLPKQERES ALYFPDQNRR PDIQNKECLL RILQQLKTEN DIALQVTNPA 120 AINSDVEELE HEVCRLQQQL QMAEEELRRY EPDPIRFTTM EEYEVSEKQL LDTLTHVVQR 180 RDHLMSNHLS SYEASTMQPN IGGPFVNDVV EGWLPENGTN QTHLFDASAH SNQLRELSSA 240 MYEPLLQGSS SSSNQNNMSE CHVTNHNGEM FPEWAQAYSS SALFASMQQQ HEGVGPSIEE 300 MMPAQQSDIP GVTAETQVDH EVSDYETKVP QLSSQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3mu6_A	1e-15	2	54	1	53	Myocyte-specific enhancer factor 2A
3mu6_B	1e-15	2	54	1	53	Myocyte-specific enhancer factor 2A
3mu6_C	1e-15	2	54	1	53	Myocyte-specific enhancer factor 2A
3mu6_D	1e-15	2	54	1	53	Myocyte-specific enhancer factor 2A
6bz1_A	3e-15	1	90	1	91	MEF2 CHIMERA
6bz1_B	3e-15	1	90	1	91	MEF2 CHIMERA
6bz1_C	3e-15	1	90	1	91	MEF2 CHIMERA
6bz1_D	3e-15	1	90	1	91	MEF2 CHIMERA
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	255952_at	0.0
Expression Atlas	AT1G22130	-
AtGenExpress	AT1G22130	-
ATTED-II	AT1G22130	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269\|PubMed:12949148}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the MIKC (MADS box, Keratin binding domain, and C terminal domain containing )family of transcriptional regulators. AGL104 is expressed in pollen.It forms heterodimers with other MICK family members (AGL65 and AGL30). Involved in late stages of pollen development and pollen tube growth.
UniProt	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G22130.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G46408

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. Pollen grains from the double mutant agl66 and agl104 have severely reduced viability, delayed germination and aberrant pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G22130

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ056457	0.0	DQ056457.1 Arabidopsis thaliana MADS-box family protein (At1g22130) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_173632.1	0.0	AGAMOUS-like 104
Swissprot	Q9LM46	0.0	AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBL	A0A178W4Y8	0.0	A0A178W4Y8_ARATH; AGL104
STRING	AT1G22130.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2179	23	65
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT1G22130.1
Entrez Gene	838818
iHOP	AT1G22130
wikigenes	AT1G22130

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] Scheible WR, et al. Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen. Plant Physiol., 2004. 136(1): p. 2483-99 [PMID:15375205] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Verelst W,Saedler H,Münster T MIKC* MADS-protein complexes bind motifs enriched in the proximal region of late pollen-specific Arabidopsis promoters. Plant Physiol., 2007. 143(1): p. 447-60 [PMID:17071640] Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Adamczyk BJ,Fernandez DE MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis. Plant Physiol., 2009. 149(4): p. 1713-23 [PMID:19211705] Hanada K, et al. Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana. Mol. Biol. Evol., 2011. 28(1): p. 377-82 [PMID:20736450] Xia C, et al. The ARID-HMG DNA-binding protein AtHMGB15 is required for pollen tube growth in Arabidopsis thaliana. Plant J., 2014. 79(5): p. 741-56 [PMID:24923357] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]