![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AMDW01038492.1_FGP001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 162aa MW: 17749.6 Da PI: 11.1094 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 291.8 | 2.8e-89 | 2 | 162 | 140 | 300 |
GAGA_bind 140 aaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWG 226 ++++++e + +kkrq++++pk+++akk+kk s++++++ ++++a+ +r++ ++k+i++v+ng++lD s++P+PvCsCtGa++qCY+WG AMDW01038492.1_FGP001 2 NVPVIDEPPPPKKRQQGRQPKVPRAKKPKK-SAAPREDGAPPNAPaPRRRGPRKNIGMVINGIDLDLSRIPTPVCSCTGAPQQCYRWG 88 57788999**********************.88999*******999****************************************** PP GAGA_bind 227 nGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvti 300 +GGWqSaCCtttiS+yPLP+stkrrgaRiagrKmS+gafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvti AMDW01038492.1_FGP001 89 AGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTI 162 *************************************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01226 | 8.6E-90 | 1 | 162 | IPR010409 | GAGA-binding transcriptional activator |
Pfam | PF06217 | 8.7E-90 | 3 | 162 | IPR010409 | GAGA-binding transcriptional activator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0050793 | Biological Process | regulation of developmental process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
ENVPVIDEPP PPKKRQQGRQ PKVPRAKKPK KSAAPREDGA PPNAPAPRRR GPRKNIGMVI 60 NGIDLDLSRI PTPVCSCTGA PQQCYRWGAG GWQSACCTTT ISTYPLPMST KRRGARIAGR 120 KMSHGAFKKV LEKLAGEGYN LNNPIDLKTF WAKHGTNKFV TI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}. | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00253 | DAP | Transfer from AT2G01930 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AMDW01038492.1_FGP001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012618 | 0.0 | CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015612725.1 | 1e-115 | barley B recombinant-like protein A isoform X1 | ||||
Refseq | XP_015612727.1 | 1e-115 | barley B recombinant-like protein A isoform X1 | ||||
Refseq | XP_015612730.1 | 1e-115 | barley B recombinant-like protein B isoform X1 | ||||
Refseq | XP_015612731.1 | 1e-115 | barley B recombinant-like protein B isoform X1 | ||||
Refseq | XP_025876706.1 | 1e-115 | barley B recombinant-like protein A isoform X2 | ||||
Refseq | XP_025876708.1 | 1e-115 | barley B recombinant-like protein B isoform X2 | ||||
Swissprot | P0DH88 | 1e-116 | BBRA_ORYSJ; Barley B recombinant-like protein A | ||||
Swissprot | P0DH89 | 1e-116 | BBRB_ORYSJ; Barley B recombinant-like protein B | ||||
TrEMBL | B8BFL7 | 1e-114 | B8BFL7_ORYSI; Uncharacterized protein | ||||
STRING | OGLUM10G00620.1 | 1e-115 | (Oryza glumipatula) | ||||
STRING | OBART10G00630.1 | 1e-115 | (Oryza barthii) | ||||
STRING | OBART10G00640.1 | 1e-115 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2211 | 36 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14685.3 | 5e-62 | basic pentacysteine 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|