![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AHYPO_004616-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 76aa MW: 8414.81 Da PI: 6.6155 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 37.5 | 4.2e-12 | 14 | 50 | 61 | 97 |
E-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS B3 61 ltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 +GWk Fv +n Lk+gDf+vF+l+++s+ l++kv+ AHYPO_004616-RA 14 GPTGWKTFVVDNMLKVGDFCVFELMENSDVALNFKVR 50 458**********************998888888875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 10.024 | 1 | 55 | IPR003340 | B3 DNA binding domain |
Pfam | PF02362 | 3.6E-10 | 12 | 50 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 5.3E-10 | 16 | 53 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 1.05E-8 | 16 | 53 | No hit | No description |
Gene3D | G3DSA:2.40.330.10 | 3.9E-10 | 16 | 53 | IPR015300 | DNA-binding pseudobarrel domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MIYLGKGSRI NKFGPTGWKT FVVDNMLKVG DFCVFELMEN SDVALNFKVR ILRGGFPSVF 60 ENKEAGTIDN PIVLE* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010694215.1 | 3e-24 | PREDICTED: B3 domain-containing protein Os04g0386900-like | ||||
TrEMBL | A0A0K9QEU5 | 2e-19 | A0A0K9QEU5_SPIOL; Uncharacterized protein | ||||
STRING | XP_010694215.1 | 1e-23 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G33280.1 | 1e-07 | B3 family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | AHYPO_004616-RA |