|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
AA5G00094 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
Family |
MIKC_MADS |
Protein Properties |
Length: 95aa MW: 10980.7 Da PI: 10.4699 |
Description |
MIKC_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
AA5G00094 | genome | VEGI | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 94.1 | 6.3e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien++ rqvtfskRrng+lKKA+ELSvLCda++++i+fs++g+ly +ss
AA5G00094 9 KKIENSTSRQVTFSKRRNGLLKKAYELSVLCDAQISLIVFSQKGRLYQFSS 59
78***********************************************96 PP
|
2 | K-box | 34.6 | 7.8e-13 | 60 | 95 | 33 | 68 |
K-box 33 reqRhllGedLesLslkeLqqLeqqLekslkkiRsk 68
+++ +l+Ge+++s+s++eLq++ +qL++sl++iR++
AA5G00094 60 SSHEKLMGEEISSCSVQELQEIDNQLQRSLRNIRAR 95
67899*****************************97 PP
|
Protein Features
? help Back to Top |
|
Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
PROSITE profile | PS50066 | 31.931 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.6E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.1E-30 | 3 | 85 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.45E-37 | 3 | 66 | No hit | No description |
PRINTS | PR00404 | 2.9E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 7.406 | 33 | 95 | IPR002487 | Transcription factor, K-box |
PRINTS | PR00404 | 2.9E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.3E-10 | 59 | 95 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0005634 | Cellular Component | nucleus |
GO:0003677 | Molecular Function | DNA binding |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0046983 | Molecular Function | protein dimerization activity |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |