![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA31G00323 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 72aa MW: 8120.23 Da PI: 3.9687 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 55.1 | 2.6e-17 | 23 | 70 | 1 | 49 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 lppGfrFhPtdeel+++yL+ kv + l+ +i+evd++++ePw+Lp AA31G00323 23 LPPGFRFHPTDEELINFYLASKVFNGGLSG-IHIAEVDLNRCEPWELPV 70 79*************************999.78**************94 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.88E-18 | 16 | 69 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 19.254 | 23 | 72 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.4E-8 | 24 | 66 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 72 aa Download sequence Send to blast |
MMLAVEDLLS EFAGEEVMNE RGLPPGFRFH PTDEELINFY LASKVFNGGL SGIHIAEVDL 60 NRCEPWELPV EV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA31G00323 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010431534.1 | 1e-37 | PREDICTED: protein CUP-SHAPED COTYLEDON 3-like | ||||
Swissprot | Q9S851 | 2e-36 | NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3 | ||||
TrEMBL | A0A3P6DIK0 | 2e-34 | A0A3P6DIK0_BRAOL; Uncharacterized protein | ||||
STRING | XP_010431534.1 | 4e-37 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7967 | 13 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76420.1 | 8e-39 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|