PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AA31G00323

Organism

Aethionema arabicum

Taxonomic ID

228871

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema

Family

NAC

Protein Properties

Length: 72aa MW: 8120.23 Da PI: 3.9687

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AA31G00323	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	55.1	2.6e-17	23	70	1	49
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 lppGfrFhPtdeel+++yL+ kv + l+ +i+evd++++ePw+Lp AA31G00323 23 LPPGFRFHPTDEELINFYLASKVFNGGLSG-IHIAEVDLNRCEPWELPV 70 79***********************999.78************94 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.88E-18	16	69	IPR003441	NAC domain
PROSITE profile	PS51005	19.254	23	72	IPR003441	NAC domain
Pfam	PF02365	5.4E-8	24	66	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 72 aa Download sequence Send to blast
MMLAVEDLLS EFAGEEVMNE RGLPPGFRFH PTDEELINFY LASKVFNGGL SGIHIAEVDL 60 NRCEPWELPV EV

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AA31G00323

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269\|PubMed:16854978}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010431534.1	1e-37	PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
Swissprot	Q9S851	2e-36	NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBL	A0A3P6DIK0	2e-34	A0A3P6DIK0_BRAOL; Uncharacterized protein
STRING	XP_010431534.1	4e-37	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G76420.1	8e-39	NAC family protein

Publications ? help Back to Top
Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]