PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

bZIP

Protein Properties

Length: 81aa MW: 9615.28 Da PI: 11.4624

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
99404	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	44.2	4.3e-14	9	67	1	59
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 +ke kr +r+ +NR++A+ R+RKka++ eLe k+ Le N +L +++++l+ke l 99404 9 DKEHKRLKRLLRNRVSAQQARERKKAYVVELEAKARDLELRNAELEERVNTLQKETFML 67 6899**************************************************97655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	2.9E-13	9	73	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	5.1E-13	10	69	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.702	11	69	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	3.1E-15	13	70	No hit	No description
SuperFamily	SSF57959	5.35E-13	13	69	No hit	No description
CDD	cd14704	2.43E-11	14	63	No hit	No description
PROSITE pattern	PS00036	0	16	31	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009737	Biological Process	response to abscisic acid
GO:0009740	Biological Process	gibberellic acid mediated signaling pathway
GO:0010017	Biological Process	red or far-red light signaling pathway
GO:0010099	Biological Process	regulation of photomorphogenesis
GO:0010114	Biological Process	response to red light
GO:0010218	Biological Process	response to far red light
GO:0010224	Biological Process	response to UV-B
GO:0031539	Biological Process	positive regulation of anthocyanin metabolic process
GO:0042753	Biological Process	positive regulation of circadian rhythm
GO:0080167	Biological Process	response to karrikin
GO:0005634	Cellular Component	nucleus
GO:0003690	Molecular Function	double-stranded DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
RKRGAVPADK EHKRLKRLLR NRVSAQQARE RKKAYVVELE AKARDLELRN AELEERVNTL 60 QKETFMLRQV KKAKVFFFLH *

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269\|PubMed:15178762}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00117	ampDAP	Transfer from AT5G11260	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002973198.1	3e-41	transcription factor HY5 isoform X1
Refseq	XP_024533940.1	3e-41	transcription factor HY5 isoform X2
Refseq	XP_024537316.1	3e-41	transcription factor HY5 isoform X1
Refseq	XP_024537317.1	3e-41	transcription factor HY5 isoform X2
Swissprot	Q9SM50	9e-29	HY5_SOLLC; Transcription factor HY5
TrEMBL	D8RQ04	7e-40	D8RQ04_SELML; Uncharacterized protein HY5B-1
STRING	EFJ22323	1e-40	(Selaginella moellendorffii)
STRING	EFJ25572	1e-40	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP2081	17	37

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G11260.1	2e-29	bZIP family protein

Link Out ? help Back to Top
Phytozome	99404

Publications ? help Back to Top
Wang F, et al. Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato. Plant Physiol., 2018. 176(2): p. 1311-1326 [PMID:29146776] Liu CC, et al. The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato. Plant Cell Environ., 2018. 41(8): p. 1762-1775 [PMID:29566255]