PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 99404
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family bZIP
Protein Properties Length: 81aa    MW: 9615.28 Da    PI: 11.4624
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
99404genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.24.3e-14967159
            XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
  bZIP_1  1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59
            +ke kr +r+ +NR++A+  R+RKka++ eLe k+  Le  N +L +++++l+ke   l
   99404  9 DKEHKRLKRLLRNRVSAQQARERKKAYVVELEAKARDLELRNAELEERVNTLQKETFML 67
            6899**************************************************97655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-13973IPR004827Basic-leucine zipper domain
PfamPF001705.1E-131069IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.7021169IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.1E-151370No hitNo description
SuperFamilySSF579595.35E-131369No hitNo description
CDDcd147042.43E-111463No hitNo description
PROSITE patternPS0003601631IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0010224Biological Processresponse to UV-B
GO:0031539Biological Processpositive regulation of anthocyanin metabolic process
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
RKRGAVPADK EHKRLKRLLR NRVSAQQARE RKKAYVVELE AKARDLELRN AELEERVNTL  60
QKETFMLRQV KKAKVFFFLH *
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00117ampDAPTransfer from AT5G11260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002973198.13e-41transcription factor HY5 isoform X1
RefseqXP_024533940.13e-41transcription factor HY5 isoform X2
RefseqXP_024537316.13e-41transcription factor HY5 isoform X1
RefseqXP_024537317.13e-41transcription factor HY5 isoform X2
SwissprotQ9SM509e-29HY5_SOLLC; Transcription factor HY5
TrEMBLD8RQ047e-40D8RQ04_SELML; Uncharacterized protein HY5B-1
STRINGEFJ223231e-40(Selaginella moellendorffii)
STRINGEFJ255721e-40(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20811737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.12e-29bZIP family protein
Publications ? help Back to Top
  1. Wang F, et al.
    Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato.
    Plant Physiol., 2018. 176(2): p. 1311-1326
    [PMID:29146776]
  2. Liu CC, et al.
    The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato.
    Plant Cell Environ., 2018. 41(8): p. 1762-1775
    [PMID:29566255]