![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 918808 | ||||||||
Common Name | ARALYDRAFT_918808 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 134aa MW: 14997 Da PI: 10.5127 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 46.9 | 9e-15 | 10 | 49 | 88 | 128 |
NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + k++++ +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl 918808 10 NVKTITA-DGRRVGIKKALVFYAGKAPKGTKTNWIMHEYRL 49 4456666.9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 18.372 | 1 | 82 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 8.5E-16 | 10 | 58 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.0E-6 | 15 | 49 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MFDKPNQEKN VKTITADGRR VGIKKALVFY AGKAPKGTKT NWIMHEYRLI EHSRSHGSSK 60 KTSGSQRQAV TTPVQACREE HSTNGSSSSS SSQLDDVLDS FPEIKDQSFN LPRMNSLIYN 120 EVKKKIKEKI KNI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
3swm_B | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
3swm_C | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
3swm_D | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
3swp_A | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
3swp_B | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
3swp_C | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
3swp_D | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 918808 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Strongly induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by cold treatment. Not induced by jasmonic acid. {ECO:0000269|PubMed:15319476, ECO:0000269|Ref.7}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF083738 | 1e-77 | AF083738.1 Arabidopsis thaliana clone sps433 unknown mRNA. | |||
GenBank | AY087772 | 1e-77 | AY087772.1 Arabidopsis thaliana clone 38344 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020871457.1 | 2e-72 | NAC domain-containing protein 72, partial | ||||
Swissprot | Q93VY3 | 5e-61 | NAC72_ARATH; NAC domain-containing protein 72 | ||||
TrEMBL | D7MLT1 | 2e-94 | D7MLT1_ARALL; Uncharacterized protein | ||||
STRING | scaffold_802208.1 | 4e-95 | (Arabidopsis lyrata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G27410.2 | 5e-62 | NAC family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 918808 |
Entrez Gene | 9300540 |
Publications ? help Back to Top | |||
---|---|---|---|
|