![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 914964 | ||||||||
Common Name | ARALYDRAFT_914964 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 63aa MW: 7054.17 Da PI: 9.326 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 30.9 | 7.5e-10 | 3 | 49 | 53 | 99 |
DUF260 53 eredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 e+++ + s +eA++r+ P+yG+vg+i+ lq+q++++k+e l+k+ 914964 3 EQQQWVISSSFEAQCRIVGPIYGCVGIISLLQSQIQTKKNENLLAKT 49 4666777889*****************************99887776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 1.8E-7 | 3 | 45 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 63 aa Download sequence Send to blast |
MKEQQQWVIS SSFEAQCRIV GPIYGCVGII SLLQSQIQTK KNENLLAKTN LVRTTLPNSY 60 FH* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 914964 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | D7MBX8 | 4e-38 | D7MBX8_ARALL; Uncharacterized protein | ||||
STRING | scaffold_702706.1 | 6e-39 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26620.1 | 4e-12 | LOB domain-containing protein 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 914964 |
Entrez Gene | 9304130 |