PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NF-YB

Protein Properties

Length: 178aa MW: 19236.4 Da PI: 5.3435

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
906721	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	184.7	7.3e-58	28	125	1	98
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 vreqdrflPian+srimk+ lP n+ki+kdaket+qecvsefisfvtseasdkcqrekrktingddllwa+atlGfedy++plkvyl++yre+eg++k 906721 28 VREQDRFLPIANISRIMKRGLPLNGKIAKDAKETMQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLMRYREMEGDTK 125 69*********************************************************************************************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.2E-53	26	142	IPR009072	Histone-fold
SuperFamily	SSF47113	2.33E-40	31	134	IPR009072	Histone-fold
Pfam	PF00808	2.6E-27	34	98	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	2.0E-20	62	80	No hit	No description
PROSITE pattern	PS00685	0	65	81	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	2.0E-20	81	99	No hit	No description
PRINTS	PR00615	2.0E-20	100	118	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
MAESQTGGGG GGGSHESGGD QSPRSLNVRE QDRFLPIANI SRIMKRGLPL NGKIAKDAKE 60 TMQECVSEFI SFVTSEASDK CQREKRKTIN GDDLLWAMAT LGFEDYIDPL KVYLMRYREM 120 EGDTKGSGKG GESSAKRDGQ PSQVSQFSQV PQQGSFSQGP YGNPQASNMM VQMPGTE*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	5e-47	28	119	1	92	Transcription factor HapC (Eurofung)
4g92_B	5e-47	28	119	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	906721

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK176827	0.0	AK176827.1 Arabidopsis thaliana mRNA for transcription factor NF-Y, CCAAT-binding - like protein, complete cds, clone: RAFL25-38-H16.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002877913.1	1e-129	nuclear transcription factor Y subunit B-10
Refseq	XP_020882266.1	1e-129	nuclear transcription factor Y subunit B-10
Swissprot	Q67XJ2	1e-115	NFYBA_ARATH; Nuclear transcription factor Y subunit B-10
TrEMBL	D7LUH2	1e-127	D7LUH2_ARALL; Uncharacterized protein
STRING	scaffold_502425.1	1e-128	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1480	27	94

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G53340.1	9e-87	nuclear factor Y, subunit B10

Link Out ? help Back to Top
Phytozome	906721
Entrez Gene	9312270

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]