 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
902030 |
| Common Name | ARALYDRAFT_902030 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
| Family |
MYB_related |
| Protein Properties |
Length: 102aa MW: 12380.2 Da PI: 10.8074 |
| Description |
MYB_related family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| 902030 | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 26.7 | 1.3e-08 | 35 | 75 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
++T++E++l+ + +++ G + W++Ia ++ gR +k++ +w
902030 35 NMTEQEEDLIFRMHRLVGDR-WDLIAGRVV-GREAKDIERYWI 75
68****************99.*********.***********5 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated |
| GO:1900033 | Biological Process | negative regulation of trichome patterning |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003677 | Molecular Function | DNA binding |
| Nucleic Localization
Signal ? help
Back to Top |
 |
| No. |
Start |
End |
Sequence |
| 1 | 76 | 88 | RNCDHCSHKRRRR |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | CP002685 | 6e-54 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
| GenBank | FJ972677 | 6e-54 | FJ972677.1 Arabidopsis thaliana ecotype Gr-1 trichomeless2 (TCL2) gene, complete cds. |
| GenBank | FJ972679 | 6e-54 | FJ972679.1 Arabidopsis thaliana ecotype Oy-0 trichomeless2 (TCL2) gene, complete cds. |
| GenBank | FJ972680 | 6e-54 | FJ972680.1 Arabidopsis thaliana ecotype Landsberg erecta trichomeless2 (TCL2) gene, complete cds. |
| GenBank | FJ972681 | 6e-54 | FJ972681.1 Arabidopsis thaliana ecotype Col-0 trichomeless2 (TCL2) gene, complete cds. |
| GenBank | U93215 | 6e-54 | U93215.3 Arabidopsis thaliana chromosome 2 BAC T6B20 genomic sequence, complete sequence. |
