PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 901407 | ||||||||
Common Name | ARALYDRAFT_901406, ARALYDRAFT_901407 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 90aa MW: 10125.5 Da PI: 6.7851 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 23 | 2.2e-07 | 44 | 76 | 1 | 33 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleev 33 lppG++F P+d++l+ +yLk+ ++g k+ l +v 901407 44 LPPGYQFVPSDQQLIFFYLKPYLDGYKNVLLNV 76 79*********************9988655443 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.41E-9 | 36 | 74 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 11.584 | 44 | 89 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MHGRNKHKER CSPEPQPQPP SENPSSSSLA ADNMPPPSTL TYLLPPGYQF VPSDQQLIFF 60 YLKPYLDGYK NVLLNVPIHI YESWPTLSI* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 901407 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020879736.1 | 2e-32 | uncharacterized protein LOC9313628 isoform X1 | ||||
TrEMBL | D7LDJ1 | 4e-58 | D7LDJ1_ARALL; Uncharacterized protein | ||||
STRING | scaffold_400907.1 | 7e-59 | (Arabidopsis lyrata) | ||||
STRING | scaffold_400908.1 | 7e-59 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM23206 | 2 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56560.1 | 5e-16 | NAC domain containing protein 65 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 901407 |
Entrez Gene | 9315033 |